KEGG   Bacillus cereus ATCC 14579: BC0384Help
Entry
BC0384            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1202737
NCBI-ProteinID: NP_830223
UniProt: Q81IK2
Position
366271..366555
Genome map
AA seq 94 aa AA seqDB search
MFNCNLFEIVVVMQNNLLKILNMRFYNIVITILMKEDVISNLLIINKMIMIITIDSLNNI
ILYRCIVNSNFDCKFCGNRLYFIENDNQRLIAEE
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaactgcaatctttttgaaatagtagtggtaatgcaaaataatttattaaaaatc
ttgaatatgagattttataatatagtaataaccatattaatgaaagaagatgtaatctca
aatttgctaattattaacaaaatgataatgattatcactattgattctttaaataatata
attttatataggtgtattgtcaatagtaattttgattgtaaattttgcggaaacaggtta
tattttattgagaatgataatcaacgattaatagctgaggagtga

DBGET integrated database retrieval system