KEGG   Bacillus cereus ATCC 14579: BC0386Help
Entry
BC0386            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1202739
NCBI-ProteinID: NP_830225
UniProt: Q81IK0
Position
367654..367851
Genome map
AA seq 65 aa AA seqDB search
MRDVRGGFPVYYIFYHYNDTGFISSYDMNILLVKHPRKQFSYVLLTQNMAKLRCPFSAFI
RKWHI
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgagagatgtacgtgggggttttcctgtttactatattttctatcattataatgacacc
ggtttcatcagttcatatgatatgaacattttattggtaaagcatcctagaaaacaattt
agctatgttttgcttacacagaacatggctaaattacgctgtccctttagcgcgtttatt
aggaaatggcatatttag

DBGET integrated database retrieval system