KEGG   Bacillus cereus ATCC 14579: BC0390Help
Entry
BC0390            CDS       T00127                                 

Definition
(RefSeq) spore coat protein B
  KO
K06325  spore coat protein B
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BC0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF150_C
Motif
Other DBs
NCBI-GeneID: 1202743
NCBI-ProteinID: NP_830229
UniProt: Q81IJ6
Position
369373..369822
Genome map
AA seq 149 aa AA seqDB search
MENVLCCDQIKCLVGETVKVNLRGPESRVGELVSLGKDYLTLQLPHGELVYYQLKHVKSL
VKKVKESKCGDCYSSCFCSDEDTFLDILKDLKYKWVKINRGGPECVEGLLSEVHHGCITL
VNGDEVIYVIKSHIKSVSQVVKCKKNEDE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttggagaatgtattatgctgtgaccaaattaaatgtttagttggtgagactgtaaaagta
aaccttcgtggaccagaaagtcgagttggtgagctcgtatcgttaggaaaagattatcta
acgttacagttacctcatggtgaattagtatattatcagttgaaacatgtgaagagtcta
gtgaagaaagtgaaagaaagtaaatgtggcgattgctatagttcatgtttctgctctgat
gaggatacttttttagatatattaaaagacttgaagtataagtgggtaaaaattaatcgt
ggcggtccagagtgtgtggaaggtttattaagtgaggtacaccatggctgtattacacta
gtaaacggtgatgaagttatttatgtaattaagtctcatattaagagtgtgagtcaagta
gttaaatgtaaaaagaatgaagatgaataa

DBGET integrated database retrieval system