KEGG   Bacillus cereus ATCC 14579: BC0392Help
Entry
BC0392            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 1202745
NCBI-ProteinID: NP_830231
UniProt: Q81IJ4
Position
370892..372157
Genome map
AA seq 421 aa AA seqDB search
MEQFPNSLSITLLGSAGGAAKAVLAILNQAIANEKDPIYEVLKNAKFHLVDIKQKDRTYY
DELFSNLKGQLYLYEINLQNVVEFKQHLKEKRTSVVIDVSGADTIRVLSCCNELGICYIN
SALENEAVDQDDSLIGFQLTERYTRFEKEKEKFTNTKAIIGSGMNPGVVQWMVVELMKER
PNERPRACYIVEHDTSFLNDTALIKPHTLYASWAVERFLDEAIWSYPMYMSHHRPLYFYE
DVYASEYKVKLGEKEFYGCLMPHEEVLILGKNFNMEVGFLYRINEYTTNIIRQNLDQVED
LWNWNRKVFNPAEEEVAGEDLVGVLLVYENSETYMYNVMNSSQVFRKYKTNATYFQVGCG
IYAGLSSLLLDQFEQGAYYVEELLLNTESKYGEYLNLYMKDFVIGHNNFTDGLLHDRVRW
M
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtggagcagtttccgaattcgttatcaattacattgcttggtagtgctggtggagcagca
aaagcagttttagcaattttaaatcaagcgatagcaaatgaaaaagatccaatttatgaa
gtattaaagaatgccaaatttcatttggtggatataaaacaaaaagataggacttattat
gatgagttgttttcgaatctgaaaggtcaattatatttatatgaaataaaccttcaaaat
gtagtggaatttaaacaacatttaaaagaaaaaagaacgagtgttgtgattgatgtttca
ggggcagatacaattagagtattaagctgctgtaatgaactaggaatttgttatattaac
tcagccttggaaaatgaggcagtagatcaggacgatagcttaattggctttcagcttacg
gaaagatatacaaggtttgagaaggagaaagagaaatttacaaatacaaaagcgattata
ggttcaggtatgaatccaggtgttgttcaatggatggttgttgagcttatgaaggaacga
ccaaatgaaaggccaagagcatgttatattgtagaacatgacacgtcatttttgaatgat
acagcacttataaagccacatacactttatgcttcatgggcagtagagcgatttttagat
gaagcgatctggagttatccgatgtatatgagccatcatcgtcctctttacttttatgaa
gatgtatatgcttcagagtataaagtgaagttaggagaaaaagaattctatggttgttta
atgccacatgaggaagtattaattttagggaaaaactttaatatggaagttggttttctt
taccgaattaatgagtatacaacaaatataattagacagaacttagatcaagtagaagat
ttatggaactggaatcgtaaagtgtttaatccagcggaagaagaggttgctggtgaggac
ttggtcggtgtgttactcgtttatgaaaatagtgagacatatatgtataatgtgatgaat
agtagccaagtttttcgtaaatataaaacgaatgcaacgtattttcaggtagggtgcggg
atttatgcgggcttgtccagtttacttttagatcaatttgaacaaggtgcttattacgtt
gaggagttgttattaaatacagaaagtaagtacggtgagtatttaaatttatatatgaag
gattttgtaatagggcataataattttacggatggattgttacatgacagggtaagatgg
atgtaa

DBGET integrated database retrieval system