KEGG   Bacillus cereus ATCC 14579: BC0393Help
Entry
BC0393            CDS       T00127                                 

Definition
(RefSeq) sporulation kinase
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_5 HATPase_c_3 HATPase_c_2 Cytochrome_CBB3 HPTransfase
Motif
Other DBs
NCBI-GeneID: 1202746
NCBI-ProteinID: NP_830232
UniProt: Q81IJ3
Position
372295..373521
Genome map
AA seq 408 aa AA seqDB search
MNKYKSLIYEERRALKVFILLFYIIFFLYDAIYYFVYPAMNISGTAVGWPEGSLGIGVPI
FVIALFPISIYLQKRGYVYSVKYLFLFGYMFINLVNNLMIYLRTDRPFEHGSMVEMLLIL
FAPVFVNRKYFYLVSFSVIGKYVFFTLLLQDLKVIIPLVLCVFYFIISHSLLKRFQSYVR
TVVEMMNNMKETENLAVIGTMSTTIAHEIRNPLTALKGFTQMQKERNPTDTMSYDIMLQE
IERVNGFVSELMLLGKPKPTNYERCNIRDILLYVVHLMESYATQYRVKCHLQVDGNLPAI
NGDDKQLKQVLLNIIKNGIESMPEGGEIHIRAYQKTQGHLCISVEDQGFGIENEKLEKIG
KAFYTTKETGTGLGLMITYKIIKEHQGSITIQSSVGVGTKVEIFLPTF
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatacaagagcttgatttatgaagaaagaagagccttaaaggtatttatatta
ttattttatattatattctttttatatgacgctatatattattttgtatatcctgctatg
aatattagtggaacagcggtaggttggccagaaggtagtcttgggataggtgtgcctata
tttgtaatagcattatttcctatttctatatatcttcaaaaaagagggtatgtatattct
gtaaaatatttatttttatttgggtacatgtttatcaatcttgtgaataatttaatgatt
tatttgcgaacggatagaccttttgaacatggcagtatggtagaaatgttattaatttta
tttgccccagttttcgtgaatagaaaatacttttatttagtgtcctttagtgtaattgga
aagtacgtatttttcacattgctattacaagatttaaaagtgataattccacttgtttta
tgtgtattttatttcattatttcacattctttattaaaacgatttcaatcttatgtaaga
acagtggttgaaatgatgaacaatatgaaagagacggaaaatttagctgtgattgggact
atgtctacaacaattgctcatgaaattcgaaatccgttaacagcgttaaaagggtttacg
caaatgcaaaaagaaagaaatccaactgatacgatgagctacgacattatgctacaagaa
attgaaagagtcaatggatttgttagtgaattgatgttgttaggaaaaccaaagccaaca
aattatgaaaggtgtaatatacgagacatccttctatatgttgtgcatctaatggaaagt
tatgcaacgcaatatagagttaaatgtcatttacaagtagatgggaatttaccggctata
aacggtgatgataagcaattaaaacaagtgttattaaatatcattaaaaatggaatagaa
tcaatgccagagggtggagaaattcatatccgtgcatatcaaaaaacgcaaggacatttg
tgtatttctgttgaagaccaaggatttggtatagagaatgagaagttagaaaaaattggc
aaggcgttttacacaacaaaggagactggtacaggacttggattaatgattacatataaa
attattaaggaacatcaagggagtatcacgatccaaagtagtgtaggagtaggaacgaaa
gtagaaatttttttgccgaccttttaa

DBGET integrated database retrieval system