KEGG   Bacillus cereus ATCC 14579: BC0397Help
Entry
BC0397            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
  KO
K07074  uncharacterized protein
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BC0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlaP CoiA Polbeta CP_ATPgrasp_1 TAP_C
Motif
Other DBs
NCBI-GeneID: 1202750
NCBI-ProteinID: NP_830236
UniProt: Q814A4
Position
376361..377143
Genome map
AA seq 260 aa AA seqDB search
MREKIELELERIEKENDVKILFAVESGSRAWGFPSKDSDYDVRFVYIHPVEWYLSIHDKR
DVIEYPISDDLDISGWDIKKALQLFAKSNPALLEWIRSPIFYSKNSNFPELLQQMSEKNF
DPKATIYHYLHMASKNYREFLQGENVKLKKYFYVLRPILACKWLEEKTTLPPVEFDRLIT
ELSLERSVLDEIEKLLIKKKAGTELDVGLKIKVLNQFLEEQIHYYQQYVKGIEKGSGIDI
ESLNTLFRDMLFEAYEKEHK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagagagaaaatcgagttggagttagaaagaattgaaaaagagaatgatgtaaaaatt
ttatttgcggtggaatcagggagtcgtgcttgggggtttccatcgaaagatagcgattat
gatgttaggttcgtttatatacatccggtagaatggtatttatcaattcatgacaaacga
gatgtaattgaatatccaattagtgatgatttagatataagtggttgggatattaaaaag
gcgttgcaactattcgcgaagtcgaatcctgctttacttgagtggattcgatcaccaatt
ttttattcgaaaaactctaattttccagaactacttcaacagatgagtgagaagaatttt
gatccaaaagcaacgatatatcattatttacatatggcttcgaaaaattatcgtgaattt
ttgcaaggtgagaatgtaaagctgaaaaagtacttttatgtattacgtcccattttagct
tgtaagtggctagaagagaaaacgactttacctcctgtagaatttgatcgattaattaca
gaattatcattagaacgtagcgtattagatgaaattgaaaagttgttaataaagaaaaaa
gcaggtactgaattagatgttggattgaaaattaaggtgctaaatcaatttttagaagaa
caaattcattactatcagcaatatgtaaaaggaattgaaaagggatcaggaatcgatatt
gagagtttaaatacattgtttcgagatatgttgtttgaagcatatgaaaaagagcacaag
taa

DBGET integrated database retrieval system