KEGG   Bacillus cereus ATCC 14579: BC0398Help
Entry
BC0398            CDS       T00127                                 

Definition
(RefSeq) benzoate transport protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4 MFS_3 DUF624
Motif
Other DBs
NCBI-GeneID: 1202751
NCBI-ProteinID: NP_830237
UniProt: Q81II9
Position
complement(377157..378467)
Genome map
AA seq 436 aa AA seqDB search
MNIMQPSAPPHLESTETIFPSSITKLVVFICWLAILADGYDLGIYGAVLPKLLEDKSWAL
SPAHAGTIASYALLGMFIGAILVGTITDLIGRKWTLICCLALFSITMGLAAIAPSPELFG
LSRFIGGIGLGGVIPTASALTVEYSPKKRQSFIYALMFTGYPLGIVLGAILSMLMLEDFG
WRIMFGIGMIPLLLIPFIIRYLPESIQFLLSRNRQEEVNQILNRFQIEFHVKDKTHQDPS
TIRKKNGFFTLFSKEYIKATLLFWITYIMGMFLIYGLNTWLPQMMRQAGYPLGSSLSFLL
MLNITAAIGALFAGAIADRIGAKIVISISYLMAAICIGLLTIKPSVTIIYLLIGLAGIGS
VGITQILNAYVTQYFPSHIRATSLGWGLGLGRVGAIAGPILVGIIMTMQYDLAWNFYLFS
FAGLIAAISVFFIPTK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattatgcaaccttcagctccacctcatctagaatctacagaaactatctttcca
agctctattacaaaacttgttgtttttatttgttggctagccattttagctgatggatat
gatttaggtatttacggtgccgttctaccaaagctcctagaagacaaaagctgggcgcta
tcaccagcgcatgctggtacaattgcaagctatgctttattggggatgtttattggagct
attctagttggaacgattacagatctaattgggcgtaaatggacgcttatatgctgttta
gcacttttttctatcacaatgggtttagcggctatcgctccttctcctgagttatttgga
ttatctcgatttataggaggaatcggattaggcggtgttatcccaacagcttcagcactt
actgttgaatattcaccaaaaaaaaggcaatcttttatttatgctcttatgtttactggc
tatcctttaggtatcgtgttaggtgctattttgtccatgcttatgttagaagatttcgga
tggagaattatgtttggtatcggaatgattccactactcctcattcctttcattattcgc
tatttacccgagtccattcaatttttattatcacgtaatcgccaagaagaagtgaaccaa
attcttaatcgttttcaaattgaatttcatgtaaaagataaaactcatcaagacccatct
actatacgaaagaaaaatggattttttactttattctcaaaagaatacataaaagcaacg
ctacttttttggatcacttatataatgggaatgtttttaatatatggtttaaacacttgg
ttaccacagatgatgcgccaggcaggatatcctcttgggtctagtctgtcatttctactt
atgctaaatattaccgcagctatcggcgcattattcgctggagcaattgctgatcgtata
ggagcaaaaattgttattagcatctcttatcttatggcagccatatgtatcggactatta
acaatcaaaccatctgttacaatcatttatcttttaattggccttgctggtattggatca
gtcggtattactcaaatattaaatgcatatgtaacacaatacttcccatcacatatccga
gctacctccttaggctggggactggggcttggccgagttggtgcaattgctggcccaatt
ctcgtcggtattattatgacaatgcaatatgacttagcatggaatttttacttattctcc
tttgcaggtcttatcgcagctatatctgttttcttcattcctacaaaataa

DBGET integrated database retrieval system