KEGG   Bacillus cereus ATCC 14579: BC0401Help
Entry
BC0401            CDS       T00127                                 

Definition
(RefSeq) cystine transport system permease
  KO
K02029  polar amino acid transport system permease protein
Organism
bce  Bacillus cereus ATCC 14579
Module
bce_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:bce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bce02000]
    BC0401
Transporters [BR:bce02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    BC0401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 TrbE VIT1
Motif
Other DBs
NCBI-GeneID: 1202754
NCBI-ProteinID: NP_830240
UniProt: Q81II6
Position
complement(381849..382541)
Genome map
AA seq 230 aa AA seqDB search
MFEIFISSYPTLLKATIVTLQLTLTSLVLGSLIGLLFAFFRISNNKVLNSIAHVYIAIIR
GTPLIVQIAILYFGITSVVVFTPFWAGAIALAIHNGAYITEIFRGSIQSVDRGQLEAARS
LGMPYPLAMRRIILPQAFRLSLPPLGNQFIIGLKDSSLVAYVGMSELWGSGLSIAAGNFQ
QLDTYIIVGAYYLILVLLFTYFVNLLEKRLQRKETNSVQVHKRNKKEVSL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaatttttatctcttcctatcccacactcttaaaggctactattgtcacatta
caattaacattaacttccctagtactcggttcattaattggattattattcgctttcttt
cgaatctctaacaataaagttttaaatagtatcgctcatgtctacattgctattattcgt
ggtacacctttaattgttcaaattgccattctctattttgggattacatccgttgttgtt
ttcacccctttttgggcaggtgcaatcgctttagcaattcataacggagcatatattacg
gaaattttccgtggatctattcaatccgttgaccggggacaattagaagcagctcgctct
ttaggcatgccttatcctttagctatgcgacgaattatattaccacaagcatttcgtctg
tctcttcctcctctaggaaaccaatttattatcggattaaaagattcttcacttgttgct
tatgtaggaatgtccgaattatggggttcaggtttatcaattgcagcaggtaatttccaa
caattagatacttacataatcgttggtgcatactatctcatacttgttcttctatttact
tattttgttaatcttttagaaaaacgactacaacgaaaagaaactaactccgtccaagtc
cataaaaggaacaaaaaggaagtttctttataa

DBGET integrated database retrieval system