KEGG   Bacillus cereus ATCC 14579: BC0402Help
Entry
BC0402            CDS       T00127                                 

Definition
(RefSeq) cystine-binding protein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
bce  Bacillus cereus ATCC 14579
Module
bce_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:bce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bce02000]
    BC0402
Transporters [BR:bce02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    BC0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd rhaM
Motif
Other DBs
NCBI-GeneID: 1202755
NCBI-ProteinID: NP_830241
UniProt: Q81II5
Position
complement(382648..383442)
Genome map
AA seq 264 aa AA seqDB search
MKRKLLTIVASITLCTSFILGACSKESSTTSSNSEKEFRYAMSGLYKPFNYKENDGKLVG
FDVEIGEALAKKMNMKATPVTNPWETLIQGLQAKKYDVILGSMAITEERLKAVSFSNPYY
RSGAQIFVAKKNTAISSPEDLKGKKIGVVKASTFKNLVAKYTDQITEYDSDITALMDLEP
GRVDAVITDQMVGLRMIKEGKSKIKEAGKPLNLDEMGIAIRKDDKEMVEKVNKALDEIIK
DGTYEKISKKWFGRNILGEEEKTK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaaactattaaccattgttgcgagcattacactatgtacatccttcatacta
ggagcttgtagcaaagaaagctctactacttcatcaaatagtgaaaaagaatttcgctat
gcgatgagtggattatacaaaccttttaactataaagaaaatgacggcaaacttgtcggc
tttgatgtagaaatcggtgaagctcttgctaaaaagatgaacatgaaggctacgcccgtt
acaaacccatgggaaacgctgattcaaggtcttcaagcgaagaaatatgatgtaatactg
ggtagtatggcaattacagaggagcgcttaaaagctgttagtttctcaaatccgtactat
cgctctggcgcccaaatttttgtggctaaaaagaataccgctatctcttctccagaagat
ttaaaaggtaagaaaattggtgttgtaaaagctagtacctttaaaaatcttgttgcaaaa
tatacagatcaaatcacagaatatgacagcgatattactgctcttatggacttagagcct
gggcgtgttgacgcagtaattacggatcaaatggttggtctacgtatgataaaagaagga
aaatcgaagataaaagaagccggaaaaccattaaatcttgatgaaatgggaattgctatt
cgcaaagatgataaagaaatggttgagaaagtaaataaagcgttagatgaaatcattaaa
gatggtacgtatgaaaagatcagtaaaaaatggttcgggcgtaatattctcggtgaagag
gaaaaaacgaagtaa

DBGET integrated database retrieval system