KEGG   Bacillus cereus ATCC 14579: BC0406Help
Entry
BC0406            CDS       T00127                                 

Definition
(RefSeq) arginine deiminase
  KO
K01478  arginine deiminase [EC:3.5.3.6]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00220  Arginine biosynthesis
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BC0406
Enzymes [BR:bce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.6  arginine deiminase
     BC0406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidinotransf
Motif
Other DBs
NCBI-GeneID: 1202759
NCBI-ProteinID: NP_830245
UniProt: Q81II1
Position
386655..387887
Genome map
AA seq 410 aa AA seqDB search
MKHPIHVTSEIGELQTVLLKRPGKEVENLTPDYLQQLLFDDIPYLPIIQKEHDYFAQTLR
NRGVEVLYLEKLAAEALVDKKLREEFVDRILKEGQADVNVAHQTLKEYLLSFSNEELIQK
IMGGVRKNEIETSKKTHLYELMEDHYPFYLDPMPNLYFTRDPAASVGDGLTINKMREPAR
RRESLFMEYIIKYHPRFAKHNVPIWLDRDYKFPIEGGDELILNEETIAIGVSARTSAKAI
ERLAKNLFSRQNKIKKVLAIEIPKCRAFMHLDTVFTMVDYDKFTIHPAIQGPKGNMNIYI
LEKGSDEETLKITHRTSLMEALKEVLGLSELVLIPCGGGDVIASAREQWNDGSNTLAIAP
GVVVTYDRNYVSNTLLREHGIEVIEVLSSELSRGRGGPRCMSMPIVRKDI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatccgatacatgttacttcagaaattggggaattacaaacggttttattaaaa
cgaccgggtaaagaagtggaaaacttgacgccagattatttgcagcaattattatttgac
gatattccatacttaccaattattcaaaaagagcatgattattttgcacaaacgttacgc
aatcggggtgttgaagttctttatttagaaaaactagccgctgaggcgttagtagataaa
aaacttcgagaagaatttgttgatcgtattttaaaagaaggacaggccgacgtaaatgtt
gcacatcaaactttaaaagaatatttactttccttttcaaatgaagaattaattcaaaaa
attatgggcggtgtacggaaaaacgaaattgaaacaagtaagaagacacatttatatgaa
ttaatggaagatcactatccgttttacttagatccaatgcctaatttatattttactcgt
gatccagcagctagcgtgggcgatggcttaacgataaataagatgagagaaccagcgcgt
agacgtgaatcattattcatggagtacatcattaaatatcatccaagatttgcaaaacat
aatgtaccaatctggttagatcgtgattataaatttccgattgaaggtggcgacgagcta
attttaaatgaagaaacaattgcgattggagtatctgctcgtacttcagctaaagcaatt
gaacgtttagctaaaaatctctttagccgacaaaataaaattaagaaagtgttagcaata
gaaattccaaaatgtcgagcatttatgcatttagatacagtatttacaatggttgattat
gacaagtttacaattcacccagccattcaagggccaaaagggaatatgaatatttatatt
ttagaaaaaggatcagatgaggaaactcttaaaattacacatcgtacttctttaatggaa
gcattaaaagaggtattaggcttaagtgaattagttcttattccatgtggaggaggagat
gtaattgcttctgctcgtgaacaatggaatgatggctcgaacacattagcaattgcgcca
ggtgtagttgttacatatgatcgcaactatgtatctaatacgttattacgtgaacacggt
atagaagtgattgaggtgctaagttcggaattatctcgtggtcgtgggggtccacgttgc
atgagtatgccaattgttcgtaaagatatttag

DBGET integrated database retrieval system