KEGG   Bacillus cereus ATCC 14579: BC0408Help
Entry
BC0408            CDS       T00127                                 

Definition
(RefSeq) arginine/ornithine antiporter
  KO
K03758  arginine:ornithine antiporter / lysine permease
Organism
bce  Bacillus cereus ATCC 14579
Brite
Transporters [BR:bce02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BC0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease Transgly_assoc
Motif
Other DBs
NCBI-GeneID: 1202761
NCBI-ProteinID: NP_830247
UniProt: Q81IH9
Position
389016..390431
Genome map
AA seq 471 aa AA seqDB search
MGEDKKLGLFTLTALVVGSMIGGGAFNLASDMAKGAGAGAIIIGWVITGIGMIALGLSFQ
NLTVKRPDLDGGIFSYAKAGFGNFMGFNSAWGYWLSAWLGNVAYGTLLFSSLGYFFPIFE
GGQNVESIIGASVLLWCVHMLILRGVQSAALVNLVTTIAKLVPVFVFIVIGIFAFHIDTF
LDGFWGQTGSFSWGAVGSQVKSTMLVTLWVFIGVEGAVVLSSRAKNRSDVGKATVIGLIG
TLIIYILITLLSLGLMQQADIAGLKNPAMAYLFESVVGKWGAIFINLGLVISVLGAWLGW
TLLASEIPYLAAKDGVFPKWFAKENKNKAPVNSLWITNGLIQIFLLTFVVSDQAYNFAFS
LASSAILIPYAFSAFYQLKHSLKSEEADRNKNIIIGLIASIYGVWLVYAAGLEYLLLTMT
LYAPGIFIFYNVQKQKSSKQIFTRVELASSVAIGALAFFAIYGLITGSITL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagataagaaattagggttgtttacactaacggctcttgtagttgggtctatg
attggcggtggagcctttaatttagcgagtgatatggcaaaaggtgctggtgctggagcc
attattattggctgggttataacaggaattgggatgatcgcactcggattatcttttcaa
aatctaactgtaaaacggccagatttagatggtggtatttttagctatgcaaaagcaggg
tttggtaattttatggggtttaatagtgcatggggatactggctatctgcttggcttggg
aatgtagcttacggtacattattgttttcttcattaggatatttcttcccgatctttgaa
ggcggtcaaaatgtagaatccattattggtgcaagcgtattattatggtgtgttcacatg
ttaattttacgtggagttcaatcagcagcccttgtgaatttagtaactacaatcgcaaaa
ttagtacctgtatttgtatttattgtcataggaatctttgcgtttcatattgatacgttc
ttagatggattttgggggcaaactggttctttttcatggggagcagttggcagccaagtt
aaaagtacaatgcttgtaactttatgggtatttattggggtagaaggggctgttgtttta
tccagtcgagcaaaaaatagaagtgatgtagggaaagcaaccgttattggcttaattggt
acactcatcatttacattttaatcacattattgtctcttggacttatgcagcaagcagac
attgcaggtttgaaaaatccggctatggcttatttgtttgaaagtgttgttggaaaatgg
ggtgctatctttattaatttaggtttagtcatctctgtattaggtgcttggttaggttgg
actttgctcgcttctgaaattccatatttagcggctaaagatggagtatttccaaaatgg
ttcgcaaaagaaaataaaaataaggctccagtaaattcattatggataacaaatggttta
atacaaatattcttgttaacattcgtcgtttctgatcaggcgtataactttgcattctct
ttagcatcttcagctattttaatcccatatgctttttcagcattttatcaactgaagcat
agcttaaagtctgaagaagcagatcgaaataaaaatataataattggcttgatcgcaagt
atttatggcgtgtggttagtttatgcagccggtttagagtatttattattaacaatgact
ttatatgcgccaggtatttttattttttacaatgttcaaaagcaaaagagttcgaagcaa
atatttactcgagtggaattagcatcatccgtagcaattggtgctttagcattctttgcg
atttatggattaattacaggcagtattactttataa

DBGET integrated database retrieval system