KEGG   Bacillus cereus ATCC 14579: BC0415Help
Entry
BC0415            CDS       T00127                                 

Definition
(RefSeq) exodeoxyribonuclease III
  KO
K06896  maltose 6'-phosphate phosphatase [EC:3.1.3.90]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BC0415
Enzymes [BR:bce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.90  maltose 6'-phosphate phosphatase
     BC0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-GeneID: 1202768
NCBI-ProteinID: NP_830254
UniProt: Q81IH3
Position
398378..399169
Genome map
AA seq 263 aa AA seqDB search
MKLLTLNCHSWQEENQIEKIQYLAKVIQEEEYDVIALQEVSQSIQAENVCGNKKKDNFGL
LLLEELKALHVKDYNITWDFSHIGYDVYEEGLAIITKHNIIKEDTFFISENEDTTYWKTR
KIVSTTIAYNGKDITFYSCHLGWWNDEEESFKGQVDRLMERVDSNKLAFLMGDFNNNARL
KGEGYEYMMQKGLYDTYELAIEKDEGTTVQGEIAGWDENKHNLRIDLILCNQSKKVHSSK
VIFNGTNRNVISDHFGVEVQLDI
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgctaactttaaactgtcattcttggcaagaagagaatcaaatagaaaagata
caataccttgctaaagtaattcaagaagaagagtacgatgtcatcgcattgcaagaagta
agtcagtccatacaagctgaaaatgtatgcggtaacaagaaaaaagataattttggactt
ttactattagaagagttaaaagcgctacatgtaaaagattacaatattacttgggatttc
tctcatattggttatgatgtgtacgaagaaggattagcaattataacgaagcataatatt
ataaaagaagatacgttcttcatttcagaaaacgaggatacaacgtattggaaaacgcgt
aaaattgtaagtacaacaattgcttataatggtaaggatataacgttttactcttgtcat
ctcggttggtggaatgatgaagaagagtcattcaaaggtcaagtcgatcgtttgatggag
cgtgtagatagcaataagctcgccttcctaatgggggattttaataacaatgctcgattg
aaaggcgaaggttatgagtatatgatgcaaaaagggttgtatgacacatatgaattagca
atagagaaggatgaaggaacgactgtccaaggtgagattgctggttgggatgaaaataaa
cataatttgcgaatcgatctaatattgtgtaaccaaagtaaaaaagttcattcttcaaaa
gttatttttaatggtacaaacagaaatgtaatttcagatcatttcggtgtagaggttcaa
ttggatatataa

DBGET integrated database retrieval system