KEGG   Bacillus cereus ATCC 14579: BC0419Help
Entry
BC0419            CDS       T00127                                 

Definition
(RefSeq) hydroxyethylthiazole kinase
  KO
K00878  hydroxyethylthiazole kinase [EC:2.7.1.50]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00730  Thiamine metabolism
bce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BC0419
Enzymes [BR:bce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.50  hydroxyethylthiazole kinase
     BC0419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HK Carb_kinase Phos_pyr_kin Bacteriocin_IId
Motif
Other DBs
NCBI-GeneID: 1202772
NCBI-ProteinID: NP_830258
UniProt: Q81IG9
Position
404960..405769
Genome map
AA seq 269 aa AA seqDB search
MNMKEISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVMAYAKEEVAEMASIAG
ALVLNMGTLRPEEVEAMLLAGKSANVNNVPVLFDPVGAGATSYRTEVARHIPAEIELASI
RGNAAEIANVINERWEIKGVDAGTGNGNVVSIARQAADELNTVAVITGKEDVVTDGERTI
VIRNGHPILTKVTGTGCLLTSVIGAFVAVEKDYVKAAVAALTFYGVASELAAAKTVEKGP
GSFQIEFLNQLANTTSSDIEKYGKIEELE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaaagaaattagtaaagtagtggatttggtgagagaatctaatccgcttgtt
cataatattacaaatgttgttgtaacaaattttactgctaacggtttgttggcacttggg
gcatcgcctgtaatggcgtatgcaaaagaagaagtggcagaaatggctagcattgctgga
gcgttagtattaaatatgggaacacttcgtcctgaagaagtagaagcgatgttacttgcc
ggtaaatcagcaaatgtgaacaatgtaccagtactgtttgatccagttggtgcaggagca
acatcgtatcggacagaagttgcgagacatattccggctgaaattgaattagcgagtatt
cgcggaaatgcagctgaaatagcgaacgttattaatgagagatgggaaattaaaggggta
gacgctggtactggaaatggcaatgttgtaagtattgcaaggcaggcagcagatgaacta
aatacagttgcggtcattactggaaaagaagatgttgttacagatggagagagaactatt
gttattcgaaatggtcaccctattttaacgaaagttacgggaacaggttgtttactaact
tctgtaataggagcatttgtagcagtggaaaaagattatgtaaaagcagcagtagcagca
ttaacgttttatggtgtagcttcggaactggcagctgctaagaccgtggaaaagggacct
ggtagtttccaaattgaatttttaaatcagttagcgaatactacttctagtgatattgag
aagtatggaaagattgaggagttagagtaa

DBGET integrated database retrieval system