KEGG   Bacillus cereus ATCC 14579: BC0420Help
Entry
BC0420            CDS       T00127                                 

Gene name
thiE
Definition
(RefSeq) thiamine-phosphate pyrophosphorylase
  KO
K00788  thiamine-phosphate pyrophosphorylase [EC:2.5.1.3]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00730  Thiamine metabolism
bce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BC0420 (thiE)
Enzymes [BR:bce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.3  thiamine phosphate synthase
     BC0420 (thiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TMP-TENI NMO ThiG DUF561 QRPTase_C
Motif
Other DBs
NCBI-GeneID: 1202773
NCBI-ProteinID: NP_830259
UniProt: Q81IG8
Position
405776..406444
Genome map
AA seq 222 aa AA seqDB search
MKEMARIEIDKMSKLLQVYFIMGSNNCTRDPLAVLKEALDGGVTIFQFREKGEGSLIGED
RVRFAKELQTLCNEYSVPFIVNDDVELAIELDADGVHVGQDDEGITSVREKMGDKIIGVS
AHTIEEARFAIENGADYLGVGPIFPTSTKKDTKAVQGTKGLAYFREQGITVPIVGIGGIT
IENTAAVIEAGADGVSVISAISLAESAYESTRKLAEEVKRSL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaatggcacgcattgaaatagataaaatgtctaagctattgcaagtgtatttt
attatgggaagtaataactgcacgagggatcctttagctgtattgaaagaagcgttagat
ggtggagtgacaatttttcagtttcgcgagaagggggaaggttctttaatcggagaagat
agagtgcgctttgcaaaagaattgcagacgctttgtaatgaatatagtgttcctttcatt
gtaaatgatgatgtagaattagccattgaattagatgcagatggtgttcatgtcggacaa
gatgatgaaggaattacatctgttcgtgaaaaaatgggagataaaattatcggcgtatct
gctcatacaattgaagaagcacgctttgcaatcgaaaatggagcagattatttaggcgtt
ggacctattttcccaacgagtacgaaaaaagatacgaaagcggttcaaggaacgaaagga
ttagcctattttagagaacaaggaattacagtgccaatcgttggtattggtgggattaca
attgaaaatacagcggcagttatagaagcgggtgcggacggtgtttcagttatttcagca
attagtttagctgaatctgcgtatgaaagtacgagaaaattagctgaagaagtaaagaga
agtttgtag

DBGET integrated database retrieval system