KEGG   Bacillus cereus ATCC 14579: BC0421Help
Entry
BC0421            CDS       T00127                                 

Definition
(RefSeq) anaerobic C4-dicarboxylate transporter
  KO
K07791  anaerobic C4-dicarboxylate transporter DcuA
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bce02000]
    BC0421
Transporters [BR:bce02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BC0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DcuA_DcuB DUF962
Motif
Other DBs
NCBI-GeneID: 1202774
NCBI-ProteinID: NP_830260
UniProt: Q81IG7
Position
complement(406560..407873)
Genome map
AA seq 437 aa AA seqDB search
MFWLQFLTLLLCIFIGARLGGVGLGVMGGVGMAILVFVFHLQPTAPPIDVMLMILAVITA
AGALQAAGGMDYLVHLAEKALRKNPKRITFFAPIVTYLFTLCAGTGHVAYSVLPVIAEVS
RESGIRPERPMSIAVIASQQAITASPISAATVALLAMLADYKITLLDILKVSIPSTFIAC
MIAAFVASKMGKELNEDPEYLKRLKEGMIPKLEEKKAFVGVKGAKLSVILFLVGTFLVVL
LGSFEALRPGWIVDGKLARLSMPNTIEMVMLTIAALIIIFCKPNVESIVSGNVFKAGATA
VVAIFGIAWMGDTFFNGNLNMIQGSIQHLVTSAPWLFAIALFILSILLYSQAATVRALMP
LGLSLGIPPALLIAMFPAVNGYFFIPNYGTIVAAINFDRTGTTGIGKYVLNHSFMIPGLI
ATFTSIGIGMLLISIMF
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgttttggctacaatttcttaccttgttactctgtatttttattggtgcacgcctaggc
ggagttggtttaggagtaatgggtggagttggtatggcaatactcgtttttgtcttccac
ctacaaccaaccgcgcctcctatcgatgtaatgcttatgattttggcagtaattacagct
gctggtgctttgcaagctgctggaggaatggactatcttgttcatctagctgaaaaggca
ttacgaaaaaatccaaagcgtattactttttttgctccaattgttacttatttattcaca
ctatgtgcaggtactggtcacgttgcctattctgtacttcctgttattgcagaagtctct
cgtgaatcagggattagaccggaacgcccaatgtcgattgccgtaatcgcttctcaacaa
gcaattacagctagtccaatttcagctgccacagttgctcttttagcaatgttagctgac
tataaaatcaccttattagatattttaaaagtaagtatcccttctactttcatcgcttgt
atgatagctgcattcgttgctagtaagatgggaaaagaattaaatgaagaccctgaatac
ttaaaacgattaaaagaaggaatgattcctaagcttgaagagaaaaaagcatttgtaggt
gtaaagggcgcaaaattatcagttatccttttcctagtaggaaccttccttgttgtactt
cttggttcatttgaagcacttcgtccaggatggatagttgatgggaagttagctcgtctt
tccatgccgaacacaattgagatggttatgttaactatcgcggctcttattattattttc
tgtaaaccaaatgtagaaagcattgtgtctggtaacgtctttaaagcaggagcaacagca
gttgttgctattttcggtatcgcttggatgggagatactttctttaacggaaacttaaat
atgattcaaggatccattcagcatttagtaacaagtgcaccttggctatttgccatcgca
ctattcattctatctattttactgtacagccaagctgcaacagtacgtgccttaatgcca
cttggactatctcttggcattccaccagcgctactgattgctatgttccctgcagtaaat
ggatatttcttcattccaaactatggaacaatcgttgctgctattaactttgaccgtact
ggtacaacaggtatcggtaaatacgtattaaatcatagttttatgattcctggcttaatc
gcaacatttacttctatcggaattggaatgctcttaatttcaattatgttttaa

DBGET integrated database retrieval system