KEGG   Bacillus cereus ATCC 14579: BC0424Help
Entry
BC0424            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiamine_BP Ykof
Motif
Other DBs
NCBI-GeneID: 1202777
NCBI-ProteinID: NP_830263
UniProt: Q81IG4
Structure
PDB: 

Position
414088..414408
Genome map
AA seq 106 aa AA seqDB search
MSQQVTMSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAMETTLEGELDVLLDVVKR
AQQACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYAKPEAI
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacaagttacaatgtcattttcagtagtaccacaagcaaaaacgaaagatgta
tattctgttgtcgataaagcaattgaagttgtgcaacaatcgggagttcgttatgaagta
ggggccatggaaacaactttggaaggagaattagatgtacttcttgatgtcgttaaacgt
gcgcaacaagcttgcgtcgatgctggagcagaagaagtgattacttctattaaaatccat
tatcgtccaagcactggtgtaacgatagatgaaaaggtttggaagtaccgtgatgaatat
gcaaaaccagaagcaatctaa

DBGET integrated database retrieval system