KEGG   Bacillus cereus ATCC 14579: BC0425Help
Entry
BC0425            CDS       T00127                                 

Definition
(RefSeq) hydroxymethylpyrimidine transport system permease
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 1202778
NCBI-ProteinID: NP_830264
UniProt: Q81IG3
Position
414386..415153
Genome map
AA seq 255 aa AA seqDB search
MQNQKQSKLITTIWLILLIAIWEGSVSLFKIEPWILPKPSAIVQELIGMKDLLLPNTMQT
LQEVIIGLFFAILLGTSIAIIMDVIPLFRILINPLLVISQTIPIVVLAPLFIIWFGYGML
PKVMVVILVCFFPIALSILEGFQTVDKDMLKLLQTMKATKWQVYQKVKFPAVLPYFFSGL
KIAVTYSVMGAIIGEWLGASEGLGVMLTRATKSFLTARVFGVAAIIVMVTLCLYFIVEFM
ARITAPWIYRKDGRK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaccagaagcaatctaaacttattacaactatttggcttatccttctcattgcg
atatgggaaggatctgtttcattatttaaaatcgaaccgtggattttaccaaagccttct
gccattgttcaagaattaattgggatgaaagatttactattaccaaatacgatgcaaaca
ctgcaggaagttataattggactattctttgcaattttattggggacgagcatcgcaatt
attatggacgttataccgttatttcgtattttaataaatccattgctcgttatttcgcaa
acaattccaattgttgtacttgcaccgctatttattatttggtttggatatgggatgttg
ccgaaagtaatggtcgtaatactcgtttgtttcttcccaattgcgcttagtattttagaa
ggttttcaaacagtagataaagacatgctgaaactgttacaaacaatgaaggcgacaaaa
tggcaagtttaccagaaagtaaaatttccagcagtgcttccatactttttctcaggttta
aaaattgcagttacatatagcgtaatgggggcaattatcggagaatggctcggtgcaagt
gaaggattaggcgttatgcttacgagggctacaaaatcctttttgactgcccgagtattt
ggtgttgcagcaatcatcgttatggtgacattatgcctgtattttatcgtagagtttatg
gcaagaataacagcaccatggatatatagaaaggacggcagaaaatga

DBGET integrated database retrieval system