KEGG   Bacillus cereus ATCC 14579: BC0429Help
Entry
BC0429            CDS       T00127                                 

Definition
(RefSeq) endochitinase
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00520  Amino sugar and nucleotide sugar metabolism
bce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BC0429
Enzymes [BR:bce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     BC0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_18 CBM_2 fn3 DUF4959 CBM49 Pur_ac_phosph_N DUF4998 Big_6 DUF2369 S_locus_glycop
Motif
Other DBs
NCBI-GeneID: 1202782
NCBI-ProteinID: NP_830268
UniProt: Q81IF9
Position
complement(417529..419553)
Genome map
AA seq 674 aa AA seqDB search
MRSQKFTLLLLSLLLFLPLFLTNFITPNLALADSPKQSQKIVGYFPSWGVYGRNYQVADI
DASKLTHLNYAFADICWNGKHGNPSTHPDNPNKQTWNCKESGVPLQNKEVPNGTLVLGEP
WADVTKSYPGSGTTWEDCDKYARCGNFGELKRLKAKYPHLKTIISVGGWTWSNRFSDMAA
DEKTRKVFAESTVAFLRAYGFDGVDLDWEYPGVETIPGGSYRPEDKQNFTLLLQDVRNAL
NKAGAEDGKQYLLTIASGASQRYADHTELKKISQILDWINIMTYDFHGGWEATSNHNAAL
YKDPNDPAANTNFYVDGAINVYTNEGVPVDKLVLGVPFYGRGWKSCGKENNGQYQPCKPG
SDGKLASKGTWDDYSTGDTGVYDYGDLAANYVNKNGFVRYWNDTAKVPYLYNATTGTFIS
YDDNESMKYKTDYIKTKGLSGAMFWELSGDCRTSPKYSCSGPKLLDTLVKELLGGPISQK
DTEPPTNVKNIVVTNKNSNSVQLNWTASTDNVGVTEYEITAGEEKWSTTTNSITIKNLKP
NTEYTFSIIAKDAAGNKSQPTALTVKTDEANTTPPDGNGTATFSVTSNWGSGYNFSIIIK
NNGTTPIKNWKLEFDYSGNLTQVWDSKISSKTNNHYVITNAGWNGEIPPGGSITIGGAGT
GNPAELLNTVISEN
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctcaaaaattcacactgctattactatctctactacttttcttacctcttttt
ctcacaaattttattactccaaatctcgcattagcagattcaccaaagcaaagtcaaaaa
attgttgggtactttccttcgtggggcgtttacggacgtaattatcaagttgctgacatt
gatgcatcaaagcttactcaccttaactatgctttcgcggatatttgttggaatggaaaa
catggaaacccttctactcatcctgataatccaaataaacaaacgtggaactgtaaagaa
tctggtgtaccattgcaaaataaagaggttcctaatggtactctcgtactcggtgaacca
tgggctgatgttaccaaatcgtatcctggctcagggacaacttgggaagattgcgataaa
tatgcccgttgcggaaatttcggggaactaaaacgattaaaagctaaatatcctcactta
aaaacaattatttccgttggtggctggacttggtctaaccgcttttctgatatggccgct
gatgaaaaaacaagaaaagtatttgctgaatctacagtagcttttcttcgcgcatatggg
tttgatggcgtagatttagactgggaatatccgggcgttgaaacgattcctggtggtagt
tatcgtcctgaagataaacaaaatttcactctccttcttcaagatgtccgaaatgctttg
aataaagcaggtgctgaagatggcaaacaatatttactaacaatcgcttcaggcgcaagc
caacgctacgctgatcatacagagctaaagaaaatttctcaaatactcgattggattaat
attatgacatatgatttccacggcggatgggaagctacttctaatcataatgcagctcta
tataaggatccaaatgacccagcagcaaatacgaatttttacgtagatggtgctataaat
gtttatacaaatgaaggtgttccagtcgataaactagtattaggcgtacccttttacgga
cgtggctggaaaagttgtggcaaagaaaataacggacaatatcaaccttgcaaaccaggt
agcgatgggaaacttgcttctaaaggtacttgggatgattattctaccggtgacacaggt
gtgtatgattacggtgatttagcagccaattacgttaataaaaatggttttgtacgctac
tggaatgacacagctaaagtaccttacttatataatgcgactacaggcacatttattagc
tacgatgacaatgaatctatgaaatataaaacagactatataaagacgaagggtttaagt
ggagcaatgttttgggaactaagcggggattgccgtacaagtccaaaatatagttgtagt
ggtccaaaattacttgatacgctagtaaaagaattacttggtggacctattagtcaaaaa
gatactgagccaccaacgaatgttaaaaatattgtagttacgaataaaaattcaaactca
gttcaattaaactggactgcatctactgataacgtaggggttacggaatatgaaattact
gctggagaagagaaatggagtacaacaacaaatagcattacaattaaaaacttaaaacct
aatacggaatacacattttcaataattgccaaagatgctgctggaaataaatcacaacct
accgctcttactgtcaaaacggatgaagctaatacgacacctcctgatggaaatggtact
gctacattttcagtcacttcgaattggggcagcggttataacttctcgattataatcaaa
aataatggaacgactcctattaaaaattggaaattagaatttgattatagcggtaattta
acacaagtttgggattctaaaattagtagtaaaacaaataatcattatgtaattacgaat
gcaggatggaatggtgaaattcctcctggtggatctattacaattggcggtgcaggaaca
ggtaatcctgccgaacttttaaataccgtcattagcgaaaactag

DBGET integrated database retrieval system