KEGG   Bacillus cereus ATCC 14579: BC0431Help
Entry
BC0431            CDS       T00127                                 

Definition
(RefSeq) thioredoxin
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 DUF2847 AhpC-TSA DUF836 DIM1
Motif
Other DBs
NCBI-GeneID: 1202784
NCBI-ProteinID: NP_830270
UniProt: Q81IF7
Position
420307..420621
Genome map
AA seq 104 aa AA seqDB search
MTTFKTIEELATYIEEQQLVLLFIKTENCGVCDVMLRKVNCVLENYDYVEKIEILLQDMQ
EIAGRYGVFTGPTILLFHNGKEILRESRFISLENLERIIQLFEE
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgactacatttaaaacgatagaagaattagcgacctatatcgaagaacaacaattggta
cttctgtttattaaaacggaaaattgtggtgtttgtgatgttatgctaagaaaagtaaat
tgcgtattagagaattatgattacgtagagaaaatagaaatattactacaagacatgcaa
gagattgcggggcgatatggagtatttacagggccaacaattttattatttcataatgga
aaagaaattcttcgtgaatcacgcttcatttcacttgaaaatctagagaggatcattcaa
ttattcgaggaatag

DBGET integrated database retrieval system