KEGG   Bacillus cereus ATCC 14579: BC0434Help
Entry
BC0434            CDS       T00127                                 

Definition
(RefSeq) macrolide-efflux protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 MFS_2 MFS_4 Chi-conotoxin NPCC
Motif
Other DBs
NCBI-GeneID: 1202787
NCBI-ProteinID: NP_830273
UniProt: Q81IF4
Position
421872..423110
Genome map
AA seq 412 aa AA seqDB search
MKMNALFKNRAFMLVMASDILQQFAIWIRNMALLYFIMERTNNDPVSVSLLSVMEYAPIF
IFSFIGGALADRWNPKRTMVTGDVLSVLSIIGIVLLLKLDYWQAIFFATLISAIVGQFSQ
PSSSRIFKRYVKEEQVANAIAFNQTLQSLFLIFGPVVGSLVYTQLGLFTSLYSLIILFLL
SAIALSFLPKWVEKEQVARDSLKNDIKEGWKYVLHTKNLRMITITFTIIGLAVGLTTPLE
VFLVIERLGMEKEAVQYLAAADGIGMLIGGIVAAIFASKVNPKKMFVFGMGILAMSFLVE
GLSTSFWITSFMRFGTGICLACVNIVVGTLMIQLVPENMVGRVNGTILPLFMGAMLIGTS
LAGGLKELTSLVTVFCIAMALILLAIGPVLRMQIKKEDVANKEALTNSLASK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaacgctttatttaaaaaccgagcatttatgctcgttatggcgtctgatatt
ttacaacaatttgcaatttggatcagaaatatggctcttttgtattttataatggagcga
acgaataatgatccggtttctgtttctttgttatcagttatggaatatgcacctattttt
attttctcgtttatcggtggtgcgctagctgatcgctggaatccgaaaagaacaatggtc
actggagatgtgttgagtgtactgtctattataggaattgtcctgttgttaaagctggat
tattggcaggctatattttttgcaacactcatttccgcgattgtaggtcagttttctcag
ccctcatcttcgcgtatatttaagcgctatgtaaaagaagaacaggtagcaaatgcgatt
gcatttaaccaaacattacagtcattatttctaatttttggaccagtggtaggatcactt
gtgtatacacaacttggtttatttacgtcactatatagcttaatcattttatttttgtta
tctgctatcgccctttcatttttaccaaaatgggttgaaaaagagcaagtggcgagagat
tcattaaaaaatgatataaaagaaggttggaagtatgttcttcatacgaaaaatttacgt
atgattacgatcactttcaccattataggcttagctgttggattaacaactccattagag
gtgtttcttgtaatagaacgccttggaatggaaaaggaagcagttcaatatttagctgca
gctgatggaataggtatgttaattggtggtattgttgctgcaattttcgcttcaaaagtg
aatccgaaaaaaatgtttgtattcggtatgggcatattagcaatgtcatttttagtagaa
gggctatctacatcattttggattactagtttcatgaggtttggaacaggtatttgttta
gcttgtgttaatattgttgtcggtacgcttatgattcaacttgtaccagaaaatatggtt
ggaagagtaaatgggacgattttaccactgtttatgggggcaatgctaattggaacttca
ctagctggaggattaaaggaactaacttcactagttactgtgttttgtatagcaatggca
cttattttattagcgatagggccagttctacgtatgcaaataaaaaaagaagatgttgct
aataaagaggcactaacaaattcgttagcttcgaaataa

DBGET integrated database retrieval system