KEGG   Bacillus cereus ATCC 14579: BC0438Help
Entry
BC0438            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YesK DUF2304 Glucos_trans_II DUF1772 Spore_YabQ YfhO
Motif
Other DBs
NCBI-GeneID: 1202791
NCBI-ProteinID: NP_830277
UniProt: Q81IF0
Position
426330..426641
Genome map
AA seq 103 aa AA seqDB search
MEGGNTMDWLDGFGIFYIIGGITIILVFAISYLLKKRFPDKQFDIIFALSLILLCLASFP
VTMIVIGGWEGMGYGFIGFFVLLGTLIGMIAHQLVKITRKSYV
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaggaaacactatggattggttagatggatttggtatcttttacatcattggc
ggaatcacgattatccttgtatttgctatttcatatttactaaagaaacggtttccagac
aaacagttcgatattatatttgcacttagtttaatacttctttgcttagcgtcctttccc
gttacaatgattgttattggtgggtgggaaggaatgggatatggatttattggtttcttc
gtcctacttggtacacttatcggtatgattgcacatcaacttgtgaaaattacgcggaaa
agctacgtataa

DBGET integrated database retrieval system