KEGG   Bacillus cereus ATCC 14579: BC0440Help
Entry
BC0440            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gram_pos_anchor
Motif
Other DBs
NCBI-GeneID: 1202793
NCBI-ProteinID: NP_830279
UniProt: Q81IE8
Position
complement(428535..429557)
Genome map
AA seq 340 aa AA seqDB search
MTKIFILASTLSLSFFSGLNIGNTTTENFQPLTNAIVQNSDHFAEGNSKDNNIPPGNNGS
QDDTGSGDNGSGGNGSGGNGSGGSGSGGNGSGGNGSGDNGSGGNGSGDNGSGGNGSGDNG
SGGNGSGDNGSGGNGSGDNGSGGNGSGDNGSGGNGSGGSGSDGSGSGGNGSGGNGSGGNG
SGDNGSGGNGSGGNGSGGNGSGGNDSGGNGSSGNGSGGNGSGGNGSGGNGSGGNGSGGNG
SGGNGSGGNGSGGNGSQGGNRVKGDSSSQGGNGSQGGNRVKGDSNSQEGTGSQGGNVKDN
TKKQGDKLPNTATHYPISILMGLSTFLIGMLLFIRRKNVK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaatcttcattttagcatcaacactctctttatctttttttagcggtttaaat
atcggtaatactacaactgaaaatttccaaccattaacaaacgccattgtacaaaatagc
gatcattttgcagaaggaaactcaaaggataataatatacctccaggaaataacggttct
caggacgatactggttctggtgacaatggttctggtggcaatggttccggcggtaacggt
tctggtggcagtggctctggtggcaatggttccggcggtaacggttctggtgacaacggt
tccggcggtaacggttctggtgacaacggttccggcggtaacggttctggtgacaacggt
tccggcggtaacggttctggtgacaacggttccggcggtaacggttctggtgacaacggt
tccggcggtaacggttctggtgacaacggttccggcggtaacggttctggtggtagtggc
tctgacggcagcggttccggtggcaatggttctggtggcaacggctctggcggcaatggc
tctggtgacaacggttctggcggtaacggttctggcggcaatggctctggtggcaatggt
tctggcggtaacgattctggcggcaatggctctagtggcaatggttctggcggtaacggt
tctggtggcaatggttctggcggtaacggttctggtggcaatggttctggcggtaacggt
tctggtggtaacggttctggtggtaacggttctggcggcaatggctctcaaggcggcaat
cgtgttaaaggtgatagcagttctcaagggggtaatggctctcaaggtggcaatcgtgtt
aaaggcgatagcaattctcaggagggcaccggttctcaagggggtaatgtaaaagataat
acgaaaaaacaaggtgataaattacctaatactgcaacgcattaccctatatctatttta
atggggctttcaacattcctaattggtatgttactgtttattcgtcgtaaaaacgtaaaa
taa

DBGET integrated database retrieval system