KEGG   Bacillus cereus ATCC 14579: BC0442Help
Entry
BC0442            CDS       T00127                                 

Definition
(RefSeq) tellurium resistance protein terD
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TerD
Motif
Other DBs
NCBI-GeneID: 1202795
NCBI-ProteinID: NP_830281
UniProt: Q81IE6
Position
430766..431362
Genome map
AA seq 198 aa AA seqDB search
MPIILEKGQKIDLTKGQPKVAKLQVGLGWDPIGQSGGFLSSLFGSKPNVDCDASVVMLEG
NRFLNKNDLVYFGNKLSTCGSIIHSGDNLTGEGAGDDETIFVELHKVPSRINRLVFVVNI
YDCVNRRQDFGMIRNAYIRIQNPQTGEELARYNLSDNYAGKTTLIAGEMYRHGSEWKFSA
VGEGTQDKNLSEIVSRYQ
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcctattattttagaaaaaggtcaaaagatcgatttaacgaaaggacaaccaaaagta
gcaaaactacaggttggcttaggctgggatccaattgggcaatcaggtggatttctgtct
tcattatttggaagtaaaccaaatgtagattgtgatgcatctgttgttatgttagaagga
aatcgttttttaaacaaaaatgatttagtttacttcggaaataaactttctacttgtggt
agtattattcattcaggagataatttaacaggtgaaggcgctggtgatgacgaaacaatt
ttcgtagaattacataaagttccaagccgtattaatcgtttagtattcgttgtaaatatt
tatgactgtgtaaatcgtcgtcaagatttcgggatgattcgtaatgcatatattcgtatt
caaaacccgcaaactggtgaagaattagcacgctataatttatcggataattatgctggc
aaaacaactctaattgcaggtgaaatgtatcgtcacggaagtgaatggaagttttcagca
gttggagaaggcacgcaagataaaaacttaagtgagattgtatcacgttatcaataa

DBGET integrated database retrieval system