KEGG   Bacillus cereus ATCC 14579: BC0443Help
Entry
BC0443            CDS       T00127                                 

Definition
(RefSeq) tellurium resistance protein terD
  KO
K05795  tellurium resistance protein TerD
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BC0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TerD GhoS
Motif
Other DBs
NCBI-GeneID: 1202796
NCBI-ProteinID: NP_830282
UniProt: Q81IE5
Position
431379..431969
Genome map
AA seq 196 aa AA seqDB search
MYMASISLKKGQKVDLTKTNPGLSKVLVGLGWDTNRYDGQNDFDLDVSIFLVGANGKVSG
AEDFVFYNNPKGANGAVEHLGDNRTGEGEGDDEAIKVDLKNVPAHIERICFTITIYDGEG
RSQNFGQVSNSFVRILDEEKNAELIRYDLGEDFSIETAVVVGELYRHAGDWKFNAIGSGF
QGGLASLCNNFGLDVE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttgtatatggcatcaatttcattgaaaaagggacaaaaggtagacttaacaaaaacgaat
ccaggtctttcgaaagttcttgtaggacttggttgggacacgaatcgttatgacggacaa
aacgatttcgacttagatgttagtattttcttagtaggcgcgaatggtaaagtttcagga
gctgaagatttcgttttctataataatccaaaaggtgcgaatggtgctgtagagcattta
ggagataaccgcactggtgaaggtgaaggcgatgacgaagcgattaaagtagatttgaaa
aatgttcctgctcacatcgaacgtatttgtttcacaattacaatttatgatggagaaggc
cgtagccaaaacttcggacaagtttctaattctttcgtacgtattcttgatgaagaaaag
aatgcagaattaattcgttacgatttaggagaagatttctctattgaaacagccgtagta
gtaggtgaattatatcgtcatgcaggtgattggaaattcaatgcaatcggaagtggattc
caaggtggattagcgtctctatgtaataactttggtttagatgtagagtaa

DBGET integrated database retrieval system