KEGG   Bacillus cereus ATCC 14579: BC0444Help
Entry
BC0444            CDS       T00127                                 

Definition
(RefSeq) tellurium resistance protein terD
  KO
K05795  tellurium resistance protein TerD
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BC0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TerD
Motif
Other DBs
NCBI-GeneID: 1202797
NCBI-ProteinID: NP_830283
UniProt: Q81IE4
Position
432055..432633
Genome map
AA seq 192 aa AA seqDB search
MVIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGADFDLDASAFLLDANGKCTKETD
FIFYNNLQSPCGSVLHTGDNRTGEGEGDDEQLVVDLKKVPADVHRIAITVTIYDAEGRSQ
NFGQVGNAFVRLANEETSEEVLRFDLGEDFSIETAVVFCELYRHNGQWKFNAVGSGFQGG
LGALVRAYGLDA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggttattcaattacaaaaaggccagaaaatcgatttaggtaagacaagccctggttta
acaaaagcagtaattggtcttggatgggatattaaatcttatgacggcggagccgatttc
gatttagatgcatctgcctttttattagatgcaaacggaaaatgtacgaaggaaactgat
tttatcttctataataatttacagtctccttgtggatctgttttacatacaggagataac
cgtacaggtgaaggtgaaggtgacgatgagcaacttgttgtggatttgaagaaagttcca
gcagatgtgcacagaattgctattacagttacgatttatgatgcagaaggccgtagtcaa
aattttgggcaagtaggaaatgcgtttgttcgtttagcgaatgaagaaacgagtgaagaa
gttcttcgttttgatttaggggaagatttctccatcgaaacagcagttgtcttttgtgaa
ttataccgtcataatggacagtggaagtttaatgcagtaggaagtggattccaaggtggt
ttaggtgcgcttgtaagagcgtatggcttggatgcatag

DBGET integrated database retrieval system