KEGG   Bacillus cereus ATCC 14579: BC0448Help
Entry
BC0448            CDS       T00127                                 

Definition
(RefSeq) calcium-transporting ATPase
  KO
K01537  Ca2+-transporting ATPase [EC:3.6.3.8]
Organism
bce  Bacillus cereus ATCC 14579
Brite
Enzymes [BR:bce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     BC0448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase_N Cation_ATPase HAD Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 1202801
NCBI-ProteinID: NP_830287
UniProt: Q81IE0
Position
complement(436528..439194)
Genome map
AA seq 888 aa AA seqDB search
MSNWYSKTKDQTLIDLETNEQNGLTDEIVSERLKQYGSNELATKQKRTLWQRIFAQINDV
LVYVLIIAALISAFVGEWADASIIALVVVLNAVIGVVQESKAEQALEALKKMATPKAIVK
RNGELKEIPSEHVVPGDIVMLDAGRYIPCDLRLIETANLKVEESALTGESVPVDKDAIYH
PSMRSDEQVPLGDQKNMAFMSTLVTYGRGVGVAVETGMNSQIGKIATLLHEADDDMTPLQ
KSLAQVGKYLGFVAVAICIVMFLIGFLQGRDTLEMFMTAISLAVAAIPEGLPAIVSIVLA
IGVQRMIKQNVIIRKLPAVEALGSVTIICSDKTGTLTQNKMTVTHFYSDNTYDRLESLNV
NNDAQRLLLENMVLCNDASYNNESQTGDPTEIALLVAGTTFNMQKDHLEKIHERVNEVPF
DSDRKMMSTVHMYNESYYSMTKGAIDKLLPRCTHIFKNGKIEILTDSDKNQILEAAGSMS
QEALRVLSFAFKQYDSNDVDINHLEENLIFIGLVGMIDPPRTEVKDSIKECKKAGIRTVM
ITGDHKDTAFAIAKELGIAEEISEIMIGTELDNVSDTELASKINHLNVFARVSPEHKVKI
VKALRAKGNIVSMTGDGVNDAPSLKQADVGVAMGITGTDVAKGAADVVLTDDNFSSIVKA
VEEGRNIYRNIKKSILFLLSCNFGEIIALFLAILLGWATPLRPIHILWVNLITDTLPALS
LGVDPEDPDVMKEKPRHAKESLFSGSVPFLIFNGVIIGLLTLIAFIAGAKFYTGDTNLFP
LFPERIDDDALLHAQTMAFVVLSFSQLVHSFNLRSRTKSIFSIGIFTNKYLVFSLLIGVL
MQVCIISIPPLANIFGVHALTMRDWGFVLLLSIIPLVVNEIIKLVKKN
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattggtacagtaagacgaaagatcaaacattgattgacctagaaacaaacgaa
caaaacggtttaacagatgagattgtaagtgaacgtttaaagcaatacggttctaatgaa
ttagctacaaaacaaaaacgcactttatggcagcgtattttcgcccaaattaatgacgtc
ctcgtatatgtccttattattgctgcccttatttctgcctttgtaggtgaatgggcggat
gccagtattatcgcgcttgttgtagttttaaatgctgttatcggtgttgtccaagaatcg
aaagcagaacaagctttagaggcattgaaaaagatggcaacacctaaagctatcgtcaag
agaaatggtgaactaaaagaaattccatctgagcacgtcgttccaggggatatcgttatg
ctcgacgccggacgatatatcccatgcgatttacgccttattgaaaccgcaaatttaaaa
gttgaagaatctgctctaactggtgaatctgtccctgttgataaagatgcaatctaccac
ccttctatgcgaagtgatgagcaagtaccactcggcgatcaaaaaaacatggcctttatg
tctactcttgtcacatatggaagaggcgtcggtgttgctgttgaaactggaatgaactca
caaattggtaagattgctacccttttacatgaagcagacgatgatatgacaccacttcaa
aaaagcttagcacaagtcggaaaatatttaggctttgttgctgtagctatttgtatcgtt
atgtttctcatcggttttttacaaggccgggatacgttagaaatgtttatgactgctatt
agtttagctgtcgcagctattccagaaggcttgccagctatcgtttccatcgttcttgca
attggtgtgcaacgtatgattaaacaaaacgttatcattcggaaactaccagctgttgaa
gccctcggttctgtcacaattatttgttcagataaaacaggtacgttaacgcaaaataaa
atgaccgttactcacttttatagtgataacacatatgatcgcttagaaagtttaaatgta
aataatgatgcgcaacgtctattgttagaaaatatggtgctatgtaatgatgcgtcttac
aataacgaatcacaaacgggagacccgactgaaattgcacttctcgttgctggaaccact
tttaacatgcaaaaagatcatttagaaaaaatacatgaacgtgttaacgaagtacctttt
gattcagatcgtaaaatgatgtcaaccgtacatatgtacaatgaaagttactatagcatg
acgaaaggcgctattgataagctcttacctcgatgtacccatatttttaaaaacggcaaa
atcgagattttaactgattctgataaaaatcaaatattagaagctgccggatcaatgtct
caagaagctttaagagtactttcattcgcatttaaacaatacgattcaaacgatgtggat
ataaatcatcttgaagaaaatcttatctttattggtcttgtcggtatgattgatccacca
cgaactgaagtgaaagattcaattaaagaatgtaaaaaagccggtattcgcacagttatg
attactggtgaccataaagataccgcctttgcaattgccaaagaacttggcattgctgaa
gaaatatcggaaattatgattggaactgaattagataacgtttctgatacagaactagct
agcaaaattaatcatttaaatgtattcgctagagtctctcctgagcataaagtgaaaatt
gtaaaggcattacgcgcgaaaggaaatatcgtttctatgactggtgacggtgtcaatgat
gcaccatctttaaagcaagctgatgttggcgtagcgatgggcattacaggaacagacgtt
gcaaaaggggcagcagatgtcgtgttaacagatgataatttctcatctatcgtgaaagcc
gttgaagaaggtagaaatatttatcgcaacataaaaaaatcaattctcttcctactctct
tgtaacttcggagaaattatcgctttatttttagccattttactcggctgggcaacacca
ctacgacctattcacattttgtgggtgaatttaattacagatacactgcctgcattatca
cttggggttgatcctgaagacccagatgtgatgaaggaaaaaccacgacatgcaaaagaa
agcttatttagcggcagcgttcctttcctgattttcaatggagttatcattggactttta
acgctaatagcttttatcgccggagcaaaattctatactggagatacaaatttatttcct
cttttcccagagcgaattgatgacgatgctctattacacgctcaaacgatggcatttgtc
gttcttagtttttctcagctcgttcattcatttaacttgcgttcaagaacgaaatcgatt
ttttcaattgggatctttacaaataaatatttagtcttctccctccttatcggtgttctt
atgcaagtttgtatcatctccatcccgccccttgcaaatatattcggtgtacatgcatta
acgatgcgagattggggatttgttctcttattaagtatcattccgcttgttgtgaatgaa
atcattaaattagtgaagaaaaactaa

DBGET integrated database retrieval system