KEGG   Bacillus cereus ATCC 14579: BC0449Help
Entry
BC0449            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1128 Acetyltransf_11 FRB_dom
Motif
Other DBs
NCBI-GeneID: 1202802
NCBI-ProteinID: NP_830288
UniProt: Q81ID9
Position
complement(439388..439612)
Genome map
AA seq 74 aa AA seqDB search
MDLSVKSEENVEYMVEAIKEKLRMVNAGAMRAASFNEEMYEDLRDIYDHVMKRETFSISE
MQAITEELGTLIKK
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
gtggatttatccgtaaagtcagaagaaaacgttgaatacatggtcgaagctattaaagaa
aaattacgtatggttaatgctggagcgatgagagctgctagttttaacgaagaaatgtac
gaagatttacgtgacatttatgatcatgttatgaaacgtgaaacattcagcattagtgaa
atgcaagctattacagaagaattaggtacattaattaaaaagtaa

DBGET integrated database retrieval system