KEGG   Bacillus cereus ATCC 14579: BC0451Help
Entry
BC0451            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4075 DUF1802
Motif
Other DBs
NCBI-GeneID: 1202804
NCBI-ProteinID: NP_830290
UniProt: Q81ID7
Position
440305..440820
Genome map
AA seq 171 aa AA seqDB search
MAKKNNIARNIAIGVAAGVAVSMLKKENREKVKNTAEKAKTKMIEIGENAKIKEKVQTVT
DKGRELADFNVVKAKVAEIKKLTPSVVETLKETKEIFSKKKVEPEEKPETIEIQAVSPKV
DELKVEEEPIVAEDGGMKEARELFMKDSNAVEKKTEAYIELKQDKEEKKSV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaaaataatattgctcgaaacattgcgattggtgtagctgcaggtgtagct
gtatccatgttaaagaaagaaaaccgcgaaaaagtaaaaaatacagcagaaaaagcaaaa
acaaagatgattgaaattggtgaaaatgcaaagatcaaagaaaaagtgcaaactgttaca
gataaaggacgcgaacttgctgatttcaatgtggtaaaagcgaaagtagcagaaattaaa
aaattaacgccatctgttgtagagacgttaaaagaaacgaaagaaatttttagtaagaaa
aaagttgaaccagaagaaaagccagaaacgattgaaattcaagctgtatctccaaaggta
gatgagttgaaagtagaagaagagccaatagttgctgaagatggtggtatgaaagaagcg
cgtgaattatttatgaaagactcaaatgcagtggaaaaaaaaactgaagcgtacattgag
ttaaagcaagataaagaagagaagaaaagcgtttaa

DBGET integrated database retrieval system