KEGG   Bacillus cereus ATCC 14579: BC0452Help
Entry
BC0452            CDS       T00127                                 

Definition
(RefSeq) ribonuclease BN
  KO
K07058  membrane protein
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BC0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB DUF1676
Motif
Other DBs
NCBI-GeneID: 1202805
NCBI-ProteinID: NP_830291
UniProt: Q81ID6
Position
440827..441693
Genome map
AA seq 288 aa AA seqDB search
MRKILEKVRRNRTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIFPGLVFLITLLGFIPI
QTEDVLSLLEVYVPDDAMNLIEVNVDKVVNQQNGGLLSFGLLSMLWFASNGVNAVMNAFN
RAYDVKETRSFITTRALSIVFTLAIIFMIVFALIVPVFGQVIGAAVFKALGLSDSFSFVW
SITRLVASFFVLFALFSFLYTFAPDRKLKRREVISGALFATVGWIVVSYSFAYYVDKFAN
YANTYGGLGGIIILMLWFYLTGWVILLGGEINGLLHHYRTGDNNSRNE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattttagaaaaggtgagaagaaatcgtacttattcgtttggtaaagattta
tatgaccggacgatgcgcgatgatgtagcgggcttggcagcacagctcgcttatttcttc
ttgcttgcaatttttcctgggctcgttttcttaattacgcttcttggatttattcccatt
caaacagaggatgtgcttagtttattagaggtttatgtaccagatgatgcaatgaactta
attgaggtaaatgtagataaagttgtaaaccagcaaaatggtggtttattatcatttggt
ttattatccatgttatggtttgcctcaaatggtgttaatgcggttatgaatgcttttaac
cgcgcttatgacgtaaaggaaacacgttcttttattacaacaagagcgttatcaattgtg
tttacattagctattatttttatgattgtctttgcgttaattgttccggtattcggacaa
gttattggagcagcagtgtttaaagcactcggtttatcagatagtttttctttcgtatgg
agcattacacgattagtagcgagtttcttcgtactatttgctttgtttagtttcttatat
acatttgcaccagatcgaaagttaaaaagaagagaagttatttcaggggcgttatttgct
actgtaggatggattgtggtgtcttactcatttgcttattatgtagataagtttgcgaat
tacgccaatacatatggtggtctcggtggtatcattattttaatgttatggttttattta
actggatgggtaattttacttggcggtgaaattaatggtttactccaccattatagaacc
ggtgacaataattcccgtaatgaataa

DBGET integrated database retrieval system