KEGG   Bacillus cereus ATCC 14579: BC0457Help
Entry
BC0457            CDS       T00127                                 

Definition
(RefSeq) TPR repeat-containing protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dynamin_N PLC-beta_C
Motif
Other DBs
NCBI-GeneID: 1202810
NCBI-ProteinID: NP_830296
UniProt: Q81ID3
Position
complement(446581..449343)
Genome map
AA seq 920 aa AA seqDB search
MTIENQFIQKVYYKTFLTEETSTPASEVLGEAYINESKNEFSNISNIRFAQGEFYYQNKD
FEAAIFKWEKVNNALALWATKNIADAYFELGFLPKAEEIYQSIQTEDTTLTMEVSLQLLS
LYIEQDRLGLAFKTISEAVAFQPDYPNITAIARSFYEKQEDWNNAIELAVQEGIRTQSLH
WFDTLITYINKGFTKNIKPEYFYESLKALYAVDQAQFKELVIALWNSYQHESLYLPWIQS
INHLFLHIETDNNDDWNEISTRYQETYFALITGNHFMHELNGLVPNLLTNWFSLTKAKDS
LVVSAAVLAWNEVSPTTLESLLVKSAGSLLSNTSAEADVNMETVSHLFETIAVWAEKNDV
DLSHQFTLLVHELCDLNVTPILIAGTSDHDKTSFVNSILGENILTETLTTPILFKDASQT
EITEFTELDIRNIPNLDEFHQITATSAQSELEKKCIEIKLPSRFLRKNKFTFLITPSIQG
QLDKNNAYFEYLQAADSLVYVLNSSSPLHSQEFDTLIYLREQVPNLQIHFVSHTNNTTTD
EKLISKLKVHFPDAQFFPYSPSQESSQQLGDVTESILSNLAKRDIEKERIEKLIWFTQKT
IAYLINERVELENTLVKSVRWNKHISVKLTGFINNLTALEKDKIRSITESYLLTKEEITR
DIHSQIPELLQSCSDLVQEDSDFKLVHEELNAAMNERVQKHVQQVLLPKFTGSIQEWIET
AHNEFIQAQAYLDEMSETFNKLYKEERMKLPCDFKLLDDWNRDVVRMTNRITVTNINILL
RFTPTQFFLKSAGKLFGNMQKNQSMLANKYKQYIETEDYTEIAHTISKQFFLQFEVFEGA
LERDIMMFFKDPLNILKQNVDAAQLEIKEDEQTLATLRSNPETYHDPLALFKLQLLQHKF
VLSTTKKHEDIFVSNESPTV
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgaaaatcaatttattcaaaaagtttactataaaacatttttaacagaagaa
acttctactcctgcatcggaagtactcggtgaagcatatataaatgaatctaaaaatgaa
ttctccaacatttctaatattcgatttgctcaaggtgaattttattatcaaaataaagat
tttgaagcagctatatttaaatgggaaaaagtaaataatgctcttgcactttgggcgaca
aaaaatattgcagatgcttattttgaactaggattcttaccaaaggcagaagaaatttat
caatctatccaaacggaagatacgactcttacgatggaggtttccttacaacttctttct
ctttatatcgaacaagatcgtttaggactcgcttttaagacgattagtgaagctgttgca
ttccaaccggattacccaaatattactgcaattgcacgttctttctatgaaaaacaagaa
gattggaacaacgctatcgaactagctgttcaagaaggtatccgaacacaatctttacac
tggtttgatacgttaataacttacataaacaaaggatttacaaaaaatattaagcctgaa
tatttctatgagtctttaaaagctctatatgctgttgatcaagctcaatttaaagaactt
gttattgctctttggaatagctatcaacatgaatccttataccttccttggattcaaagt
attaatcatttattcttgcatattgaaacagacaataatgacgattggaatgaaatctct
actcgctaccaagaaacatactttgcattaattaccggaaatcattttatgcatgaatta
aacggacttgtaccaaatttattaacaaattggttcagtttaacgaaagcaaaagattct
ctagttgtctctgcagcagtgttagcatggaatgaagtctcacctacaactttagaatca
ttactcgtaaaaagtgctggatccttactttctaatacatcagctgaagcagatgtaaat
atggaaacagtttctcatttattcgaaacaatcgctgtatgggctgagaaaaatgatgta
gatttaagtcatcaatttacgctactcgtccatgaactatgtgatttaaatgtcacacca
atactaatagctggaactagtgaccatgataaaacatcatttgttaattcaatattggga
gagaacatcttaactgaaactttaacaactcctattctatttaaagacgctagtcaaact
gaaataacagaatttaccgagttagatataagaaatatccctaaccttgatgaattccat
caaataacggctacatctgctcagtcagaacttgagaaaaaatgtatagaaattaagcta
ccaagtaggtttttaagaaaaaataagtttacatttcttattacaccatctattcaagga
caattggataaaaacaatgcatactttgaatacttacaagcagcagatagccttgtatac
gtattaaattcttcttcaccattgcatagtcaagaatttgatacgttaatttatttacgt
gaacaagtaccaaacttacaaattcacttcgtatcacacacaaataatacgactactgat
gaaaaactaattagtaaacttaaagtacattttccagatgcacaattcttcccatactct
ccttcgcaagagagtagccagcaacttggagatgtaacagaatctattctttctaatctt
gcaaaacgcgatatagaaaaagaacgtatagaaaagctaatatggtttacgcaaaagacc
attgcttatctcataaatgaacgtgtggaattagaaaatacattagtaaaatccgtacgc
tggaataaacacatctcagtgaaacttactggatttattaataaccttactgctcttgaa
aaagataaaattcgttctattaccgaatcctatcttttaacgaaagaagaaattacacga
gatatacattctcaaattcctgaattattacagagctgctctgatcttgttcaagaagat
agtgatttcaaattagttcatgaagaattaaatgctgcaatgaatgaacgagttcaaaag
catgtacaacaggtacttcttcctaaatttactgggtctattcaagaatggattgaaaca
gcacataatgaatttattcaagctcaagcttatttagatgaaatgagtgaaacgtttaat
aaattatataaagaagaacgtatgaaacttccttgcgatttcaaattattagatgattgg
aatcgagatgttgtacgaatgacaaatcgaattacagtaacgaacatcaatattttatta
cgctttacaccgacacagtttttcttaaaaagtgccggaaaattatttggtaatatgcaa
aaaaaccaatctatgctcgccaacaaatataaacaatatattgaaacagaagactataca
gaaattgctcacacaatttcaaaacaattcttccttcaatttgaagtatttgaaggtgca
ttagaacgtgatatcatgatgttcttcaaagatccacttaatatattgaaacaaaatgta
gatgcagctcaacttgagataaaggaagacgagcaaacattagcaacgctaagaagcaat
ccagaaacatatcatgatcctttggcgttatttaaactacaattgctacaacataaattc
gttttaagtactacaaagaaacatgaagatatttttgtatcaaacgaatctcctactgtt
taa

DBGET integrated database retrieval system