KEGG   Bacillus cereus ATCC 14579: BC0478Help
Entry
BC0478            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mntp
Motif
Other DBs
NCBI-GeneID: 1202831
NCBI-ProteinID: NP_830315
UniProt: Q81IB6
Position
468452..469063
Genome map
AA seq 203 aa AA seqDB search
MSTAGLFSIFLIGIASNLDNAGVGIAYGIRKIRISWFNNFIIAFFGFLFTLLAGFFGNWI
ALFISEFTANLIGAIVLGIIGVFILCQPFLGQRNTVGSKDGNVLMGILRDPEKADFDGSK
TISFSEAIVLGIALSINNIAGGFDAGITNLNLWLTATISGVFSFICISGFAYVGKRFLAE
YLGKWATIIAEVLLILIGIDQLL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagtacggcaggtctattttcaatttttttaatcgggattgcttctaatttagataat
gcaggtgttgggattgcatatggcattcgtaaaattagaatttcgtggttcaacaatttt
atcatcgcattttttgggtttttatttactttattagctggattttttgggaactggatt
gcgttatttatttcagagtttacagcaaacctgattggagcgatagttttagggataatc
ggggtgtttattttgtgccagcctttcttggggcaaagaaataccgtaggctctaaagat
ggtaatgtacttatgggaattttacgtgatccagaaaaagcagattttgatggttctaaa
acaattagtttttcagaagcaattgtattagggattgcgttgtctattaataatattgca
ggtggatttgatgctgggataacaaatttaaatctttggcttacagcgactatttctggg
gtgtttagttttatttgtattagtggttttgcgtatgtaggaaaacgatttttagcagaa
tacttagggaaatgggcgacaattatcgcagaagtattattaattcttattgggatcgat
cagttgttgtaa

DBGET integrated database retrieval system