KEGG   Bacillus cereus ATCC 14579: BC0481Help
Entry
BC0481            CDS       T00127                                 

Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00220  Arginine biosynthesis
bce00250  Alanine, aspartate and glutamate metabolism
bce00471  D-Glutamine and D-glutamate metabolism
bce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BC0481
   00220 Arginine biosynthesis
    BC0481
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BC0481
Enzymes [BR:bce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BC0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase TIMELESS
Motif
Other DBs
NCBI-GeneID: 1202834
NCBI-ProteinID: NP_830318
UniProt: Q81IB3
Position
complement(469875..470804)
Genome map
AA seq 309 aa AA seqDB search
MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIFHKETEYIHAGNSQTL
FTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLETTSPSKPLNPMINAGA
LAITSMLEGKDNEEKMERILHFVREITDNPTINYSSKVADSELETAYLNRSLCYYMKQNG
IIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYKKKQIIPKHITKICKTFMV
TCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGDMGIGIFGPALDANGNSIAGFKILELL
SAQEGWSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcattgaaacaaacaacttacaacagttgttagaacaagtaaaaccatataca
aaaaaaggaaaacttgctacttatatccccgaactaggaaatgcaaatccagacgattta
gggattgccattttccataaagaaacagaatatatccatgcaggcaactcacaaacacta
tttactcttcaaagtatttccaaagtaattacacttgcccttgcccttttagaccgtggt
gaagaatatgtattttctaaagttggaatggaaccaacgggtgacccatttaattctatt
attaagttagaaacgacaagtccgtccaaaccccttaatccaatgataaatgcaggagca
ttagctattacaagcatgttagaaggaaaagataacgaggaaaaaatggaacgtattctt
cattttgtacgtgaaataacagataatcctactattaattattcctctaaagttgccgat
tcagaactagagacagcttacctaaaccgttcactttgttattatatgaaacaaaacgga
attatcgattgtgatattgaagaacttatggatttatatactcgtcaatgcgcagttgaa
gtaaactgcatcgatttagcacgtatcggcttaatttttgcaatggatggatatgatcca
tataaaaagaaacaaatcatccctaaacatattacaaaaatttgcaaaacatttatggtc
acatgtggtatgtataacgaatctggtgaatttgcaattcgtgttggtattcctgcaaaa
agcggtgtagccggtggtatttttggctgcgtaaaaggagacatgggaatcggtattttc
ggaccagctttagatgcaaacggaaatagtattgctggttttaaaattcttgaacttctt
tctgctcaagaaggttggagcattttttaa

DBGET integrated database retrieval system