KEGG   Bacillus cereus ATCC 14579: BC0483Help
Entry
BC0483            CDS       T00127                                 

Definition
(RefSeq) penicillin-binding protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Connexin Beta-lactamase2 DUF4577 Nucleoside_tran DUF4834 SID-1_RNA_chan CLN3 Serinc MMM1 MAP17 DDHD Presenilin OATP Baculo_E56 Neur_chan_memb Zip RNA_pol_Rpc4 EMC3_TMCO1 Peptidase_S49_N O-antigen_lig Ly49 V_ATPase_I DUF4446
Motif
Other DBs
NCBI-GeneID: 1202836
NCBI-ProteinID: NP_830320
UniProt: Q81IB1
Position
472862..474133
Genome map
AA seq 423 aa AA seqDB search
MSKGKKAIMDQEKNNANGKAHRPIVYIKRTIILVLLLSLVYFMYTKIVAHNKKEETLKAA
AEMKKQEELKKKEEKKKQEVQKQKQKEQEEQMKQAQAAEKPAEGPPQEINENAQLDQYLQ
NAGFSGTAVIVKNGKVLLNKGYGMANKEQQVPNNSETTFYIGSISKAFVATAIMQLKDQN
KLQVEDTVAKYIPDFPQGNNIQLKHLLTHTSGIPEYEQGKEDISHEELIKRIGNQKRIGG
PGEKWKYSDSNYSILAYIAEKVSGQSLEEYIKQHIFATAGMKHSGFGTALEQTRFPSTGY
KIVNNNMTTPNIPSMSQLYGCGDIYTSAHDLYLFNEALYSGKLISKESYDQMFTGGKKDY
GFGWYVDPGSYSNHGVMPGWNCLNGFSKNGSVYVVLLSNIQNNIKSFGKVNNDIYSILRN
IEV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaggggaaaaaagcaattatggatcaggaaaaaaataatgcgaatgggaaagca
catcggccgattgtatacataaaaagaacaatcattctcgtcttactattatcacttgta
tatttcatgtatacaaaaattgttgcgcataataagaaagaagaaactttaaaagcggca
gcagaaatgaagaaacaagaagagttaaaaaagaaagaagaaaaaaagaaacaagaagta
cagaagcaaaaacaaaaagagcaggaagaacaaatgaagcaagcgcaagcagcggagaaa
cctgctgaaggaccacctcaagaaattaatgaaaacgctcaattggaccagtatttacaa
aacgcaggatttagcgggacagctgttattgtgaagaacggaaaagttcttctgaataaa
gggtacggtatggcaaataaagagcagcaagtaccgaataattcagagacgactttttat
attggttctatttcaaaggcgtttgtagcaactgctattatgcaattgaaagatcaaaat
aaattacaagtagaagatactgttgcgaagtatattccagattttccacaaggtaataat
attcagctaaaacatctattaacacatacatcagggattcccgaatatgagcagggaaaa
gaagatatttctcatgaagaactgataaagcggataggaaatcaaaagcgtattggtggt
ccgggagagaagtggaagtattctgattcgaactactctatacttgcttatattgcagag
aaggtaagtgggcagtcactcgaagaatatattaaacaacatatttttgctactgcgggt
atgaaacattctggctttggcacagcgttagaacaaacaagattcccatcaacgggttat
aaaatagtaaataataatatgacaacacctaatattccaagcatgtcacaactttatggt
tgtggtgatatatatacgagtgcacatgatttatatttatttaatgaggcgttatactct
ggaaaattaatttcaaaagagagttacgatcaaatgtttacgggtggaaaaaaggattac
gggtttggatggtacgtagacccaggaagctattcgaatcatggtgtaatgccaggttgg
aattgcttaaacggatttagtaaaaatggtagtgtatatgttgttttattatctaacatt
caaaataatattaaatcatttggtaaagtgaataatgacatttattcgatattgcggaat
attgaagtgtaa

DBGET integrated database retrieval system