KEGG   Bacillus cereus ATCC 14579: BC0484Help
Entry
BC0484            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YonK DUF2642
Motif
Other DBs
NCBI-GeneID: 1202837
NCBI-ProteinID: NP_830321
UniProt: Q81IB0
Position
474290..474691
Genome map
AA seq 133 aa AA seqDB search
MCLFRKYWHKLSRLFNRQLDYFLDNKLLPAVERLLFSQNFARFIQRNSKQATEEVIESSR
FQSIICNILKECNTSPFKEIAKQYLGKNVEITVTVGQLTGVIVAVGDDFLTLQEGIGTEV
LLPFISIISIKEA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtgtctgttcagaaaatattggcataaattatcaagattgtttaatagacaattagat
tattttttagataataagttattgcctgctgtggaaagacttttattttcacaaaacttc
gcgaggtttattcaaagaaactctaagcaagctacggaagaagttattgaatcaagtaga
tttcaatctattatttgtaacattttaaaagaatgcaatacatcaccttttaaagaaatt
gcaaagcagtatttaggtaaaaacgtagaaattacggtgacagttggacaattaacaggt
gttattgtagcagttggtgatgacttcttaacattgcaagaaggaataggaacagaggtt
ttattaccatttataagtattatatcaattaaagaagcgtaa

DBGET integrated database retrieval system