KEGG   Bacillus cereus ATCC 14579: BC0489Help
Entry
BC0489            CDS       T00127                                 

Definition
(RefSeq) cell wall biosynthesis glycosyltransferase
  KO
K00786  glycosyltransferase [EC:2.4.-.-]
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BC0489
Enzymes [BR:bce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BC0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-GeneID: 1202842
NCBI-ProteinID: NP_830326
UniProt: Q81IA5
Position
478637..480193
Genome map
AA seq 518 aa AA seqDB search
MNKTMAKSLSVIIPACNEVDTISDVIQSVRPLNPVEIIVVANGCNDGTEDVADRLGCKVI
KHTELLGNDVGRAVGAKHAIGDVLLFIDGDFAIPTSKLKLFLNPILYDQADVVLNNLDAL
FLKRQKTTSITVWRQILNAMLEREELKMNSLLDVPHALTKEVVQSIGYECFVNPIVAHLR
LVQSKWRISRHCAIDVITPNKFRPFQHAAYGTNLSQSEKRMIGDHIEAVAERILSSDERG
GYYDGNRKRDSVYHTLSFEEFYQGWGVTSDFYKGKQLSVVIPVQDEEKTIGNVIEELRKI
EPFEIIVVVNGSSDKTKKIAKDKGATTIVYKEALGNDVGRSLGTYFAKGEIVLFIDGDFV
IPASELYPFAKAIADGTDVALNDLNHYLDLRVPLHLVTAFKYALNLACDRKDLGVGSLIA
VPNAFSRKCLKEIGYRSLLAPCVAQVKAILSGFEVACVSRVEVDKMNRIRPSEHFAKIGH
PPAVLRIIGDHIEGLDQIIALTDNRGGFYDGNRKRDVL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaaacaatggctaagtcattatctgttattattcctgcatgtaatgaggtcgat
acgatttcagacgttattcaatcggtaagaccattaaatccagtagaaatcattgtagta
gcaaacggttgtaatgatggaacagaagatgttgcagatcgtttagggtgtaaagtaatc
aagcatacagagctactagggaacgatgttggacgtgcagtcggcgcaaaacatgcgata
ggtgatgtattactattcatagatggtgattttgctattccaacttcaaaattaaaatta
ttccttaatccgattttatacgatcaggcagatgtagttttaaataatttggatgcatta
tttttaaaaaggcaaaaaaccacttctattacagtatggcgccaaatattaaatgcaatg
ttagagcgtgaagaattaaaaatgaattctttattagatgtacctcatgcgctgacgaaa
gaagtcgttcaaagcatcggatatgaatgttttgttaatcctattgtggctcatttacgc
ctagttcaaagtaaatggagaattagtcgtcattgtgctattgacgttattacgccgaat
aaatttcgtccattccagcatgctgcatatgggacaaatctttcccaatctgaaaaaaga
atgataggtgatcatatagaagcagtagcagaacggatattaagcagtgatgagcgcgga
ggatattatgatggaaataggaaaagggatagtgtctatcatactttaagttttgaagag
ttttatcaagggtggggtgttacatctgatttctataaaggaaagcaactatcggttgtt
attcccgtacaagatgaagagaaaacaattggaaacgttatagaagagcttcgcaaaatt
gaacccttcgaaattatcgttgtcgtaaatggttcgtcagataaaacgaaaaaaattgca
aaagacaaaggggcaacgacaattgtatataaagaagcactcggaaatgatgtggggcgc
tcacttggaacgtattttgcaaaaggagaaattgtgttatttatagatggcgattttgtt
attccagcgagtgagctatatccttttgcgaaagctattgcagatggaacagatgttgca
ttaaatgatctaaatcattatttagatttaagagtaccgcttcatcttgtaactgcattt
aaatatgcattaaatttagcttgtgatagaaaagatctaggcgtaggctctcttatcgct
gtaccgaatgcgtttagccgtaagtgtttgaaagaaattgggtatagatctttactggcg
ccgtgtgtagcccaagtgaaagctattctttcaggatttgaagttgcatgtgtaagtcgt
gttgaggtcgataagatgaaccgtattcgtcccagtgaacattttgctaaaataggtcat
ccaccagctgtacttcgaattataggtgatcatatagaaggactagatcaaataattgca
ttaacagacaatcgtggcggattctatgatggcaatagaaaaagagatgttttatag

DBGET integrated database retrieval system