KEGG   Bacillus cereus ATCC 14579: BC1128Help
Entry
BC1128            CDS       T00127                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00630  Glyoxylate and dicarboxylate metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01120  Microbial metabolism in diverse environments
bce01200  Carbon metabolism
Module
bce_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BC1128
Enzymes [BR:bce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BC1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 1203477
NCBI-ProteinID: NP_830914
UniProt: Q81GQ9
Position
1110235..1111512
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQESWELDERWEGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWTSLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSDDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTNAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKEH
PGKLLAYNCSPSFNWKQKLDEKAIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaagttacaagaaagctgggaattagatgagcgttgggaa
gggatcacacgtccatattcggcagaagatgtaattcgcctgcgcgggtcaattgatatt
gaacatacgttagcgcgtcgcggtgctgagaagctttggacatcgcttcatacagaagac
tatattaacgcacttggcgcattaacaggaaaccaagcgatgcaacaagtaaaagctggg
ttaaaagcgatttacttaagtggttggcaagtagcagctgatgcaaacctttctggacat
atgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtagtaaaacgaatt
aatcaaacgcttcaacgtgcggatcaaattcagcatatggaaggaagcgatgatacagac
tatttcgtaccgattgtagcagatgcagaagctggatttggtgggcaattaaatgtattc
gaactgatgaaaggtatgattgaagcaggtgcatcaggtgtgcattttgaagatcaatta
tcttcagagaaaaaatgtggccatttaggtggaaaagtactactaccaacgcaaacagca
gtacgcaatttaatttctgcacgccttgcagcagatgtaatgggagtgccgacaattatc
gttgcaagaacagatgcggatgcagctgatttaattacgagcgatatcgatcctgttgat
aaagcatttattacaggagaaagaacaccagaagggttttaccgtacgaatgcaggtctt
gatcaagcaattgcgcgcggtttagcgtatgcaccgtacgcagacctcgtttggtgtgaa
acgtcagaaccaaatttagaagatgcaaaacgatttgcggacgcaattcataaggagcat
ccagggaagctacttgcatataactgctcaccttcattcaactggaaacaaaaactagat
gaaaaagcaattgcaagcttccaaaaggaaatcgcatcttacggttacaagttccaattc
gtaacacttgctggattccattcattaaattacggtatgtttgaactagcacgtggctat
aaagagcgcggcatggcagcatactctgaactacaacaagcagaattcgcagctgaaaaa
catggctactctgcaacacgtcatcaacgcgaagtaggaacaggttactttgatgaagtt
gcacaagtgattacgggcggaacttcatcaacgacagcgttaaaaggatctacggaagaa
gcacagtttacgaaataa

DBGET integrated database retrieval system