KEGG   Bacillus cereus ATCC 14579: BC2489Help
Entry
BC2489            CDS       T00127                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00010  Glycolysis / Gluconeogenesis
bce00620  Pyruvate metabolism
bce00640  Propanoate metabolism
bce00680  Methane metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01120  Microbial metabolism in diverse environments
bce01130  Biosynthesis of antibiotics
bce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC2489
   00620 Pyruvate metabolism
    BC2489
   00640 Propanoate metabolism
    BC2489
  Energy metabolism
   00680 Methane metabolism
    BC2489
Enzymes [BR:bce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BC2489
Lipid biosynthesis proteins [BR:bce01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BC2489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 1204838
NCBI-ProteinID: NP_832248
UniProt: Q81D87
Position
2457960..2459900
Genome map
AA seq 646 aa AA seqDB search
MKQAVWFPTEEYKEKTRLYGWMKSLGYEDYETFYNKSIEETAWFWGEAEKAVGYQWMKPY
TDVLDLENGTPFAQWYNGGTCNVVESALSRWLADEETRIQPALQYEGENGTSKSFTYEEL
DNWVSRVANGLKHAGIEKGDRVTIYMPMIPETVVAMLAVMKIGAIISPIFSGFASDAVMT
RVQAAGSKMIITADGFSRRGKIVSLKDEVDKACEHCPTVEKVVIVRHAGNDFTPHNYDFS
WSTLEKEKPFIHAEEMQSDDPLMLIYTSGTTGKPKGTVHTHAGFPLKAAFDAGFGMNIKQ
GDRVLWVTDMGWMMGPFLLFGSLINGATMVMYEGVPDFPEADRLWETVDKYEITHLGISP
TLIRALMAKGDEYVNKHSLKSLEVFASTGEPWNPDPWMWLFETVGKGNVPICNYSGGTEI
SGGIFGNVLIKPIAPISFNASLPGMAAVVLDDQGKPIRDEVGELCLEKPWVGMTKSFWED
DERYVNTYWSRFENKWVHGDWVIYDGEQYIITGRSDDTLNIAGKRIGPAEYESILVKHND
VIEAAAIGVPDEVKGEVCHCFVVLRDHVTFTGELKKELMSLVNSHIGKALCPKDIHVVED
LPKTRNSKVMRRVIKAAYLGKELGDLSSLVNPEVVPFIQGLQSSKL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaagcagtttggtttccaacagaagagtacaaggaaaaaacacgtttatatggt
tggatgaaatcattgggatatgaagattatgaaactttttataataaatctatcgaggaa
acagcttggttttggggagaggcagaaaaggcagtaggctatcaatggatgaaaccttat
acagacgtgttagatttagaaaatggtacaccgtttgcacagtggtataatggcggaaca
tgtaacgttgtagaatcagctttatcccgctggcttgcggatgaagagacgagaatacag
ccagcacttcagtacgaaggggaaaatggaacttcaaaatcatttacatatgaagagctt
gacaactgggtaagtcgtgttgcaaatggtttgaaacacgcgggtattgagaaaggtgac
cgtgtaacaatttatatgccgatgattccagaaacagttgttgcgatgctagctgtaatg
aaaatcggagcaattatttcaccaatattctcaggctttgcgtctgatgcagtcatgaca
cgtgtgcaagcggcaggttcaaaaatgattattaccgcagatggattttcacgccgcggt
aaaattgtttctttaaaagatgaagtagataaagcttgtgaacattgcccaactgttgaa
aaagttgttatcgttcgtcatgcaggaaatgattttacaccacataactatgacttttcg
tggagtacgctagaaaaagaaaaaccattcatacatgccgaggaaatgcaaagtgatgat
ccattaatgctcatttatacatcaggaacgactggtaagccgaaaggaacagtacacacg
catgcaggatttcctttgaaagcagcttttgatgcaggatttggaatgaatattaaacaa
ggtgatcgtgtattatgggtaactgatatgggctggatgatggggccgtttctattattc
ggttcactcattaatggagcaacgatggttatgtacgaaggtgttccagacttcccagaa
gcagaccggttatgggagacagttgataaatatgagattactcatctaggtatttcgcca
acgttaatccgagcattgatggcaaaaggtgatgagtatgtcaataaacattctttaaag
agtttggaagtattcgcatcaacaggagaaccttggaatcctgatccatggatgtggctg
tttgaaacggttggaaaaggaaatgtcccaatctgtaactactcaggtggaactgaaatc
tctggtgggattttcggtaatgttcttattaagccaatagcaccgattagttttaacgca
tctttaccaggaatggcagctgtcgtactggatgatcaaggtaaaccaattcgagatgaa
gtcggagaattatgcttagagaaaccttgggtaggtatgacgaaaagcttctgggaagat
gatgaacgttacgtaaacacatattggtcgcgttttgaaaataaatgggtccacggtgac
tgggtcatttacgatggtgaacaatatatcatcacagggcgttcagacgatacgttaaat
attgcaggtaaacgtattggacctgctgaatatgaatctattcttgtgaaacataacgat
gtaatcgaagctgctgcaattggtgtacctgacgaagtaaaaggtgaagtttgtcattgt
tttgtagtgttaagagatcatgtaacattcacaggagaattaaagaaagaattaatgagt
ttagtaaactctcatattggaaaagcgttgtgtcctaaagacatccacgttgtagaagat
ttaccgaaaacacgtaattctaaagtaatgcgccgtgttattaaagcagcttacttagga
aaagaattaggtgatttatcatcgcttgtaaatcctgaagtagttccgtttattcagggg
ttacagtctagtaaattataa

DBGET integrated database retrieval system