KEGG   Bacillus cereus ATCC 14579: BC3167
Entry
BC3167            CDS       T00127                                 

Definition
(RefSeq) xanthine dehydrogenase FAD-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00230  Purine metabolism
bce01100  Metabolic pathways
bce01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BC3167
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BC3167
SSDB
Motif
Pfam: FAD_binding_5 CO_deh_flav_C
Other DBs
NCBI-GeneID: 1205514
NCBI-ProteinID: NP_832908
UniProt: A0A5B7VIU5 Q81BJ0
Position
complement(3137321..3138160)
AA seq 279 aa
MIPFDFEYYRPNSITEALQLYSKLYQEGKTPIYYNGGTEIITLGRLGNLSLKSVIDIKEI
PECNVLGRYQRYVVLGSALTLTHVSDSNVFPLLSKTASRVADRTARNKITLGGNIAGEIC
YREAVLPFLLADSTLGIVGMKGIRYVSIHSLFIERLQLSKGEFLLQVLTDIEYVGLPFYS
VKKRKLEKIDYPLITLAALKKGNKIRMAFSGLCAFPFRSTAMEFAINNNQMSVEERIENT
VLRIPAPVLDDIRGSREYRLFVLRNILRDMLEHFEGGIF
NT seq 840 nt   +upstreamnt  +downstreamnt
atgattccatttgactttgaatattaccgccccaactctataacagaagcattacaacta
tattctaagctttatcaagaagggaaaacgccgatatattacaacggtggaactgaaatt
attacccttggtagattggggaatctttctctcaagtctgtaattgatataaaggaaatt
ccggaatgtaatgtgcttggaaggtatcagcgttatgtagttcttggttcagcacttact
ttaactcatgtttcagattcgaatgtgtttccacttttgagtaaaacagcgtcaagagta
gcagaccgtacagcacggaacaaaattactttaggtggaaacattgcaggggaaatctgt
tatagagaggcagtgcttccgtttttattagcagacagcactttgggaattgtaggaatg
aaaggtatacgttacgtctctatccattctctatttatagaaagactacaattaagtaag
ggagaatttcttttacaagtcttaactgatatagagtatgttggactacctttttatagt
gtgaaaaagagaaaacttgaaaaaattgattacccattaattacactagctgctttgaaa
aaaggaaataaaattcgtatggcatttagtggattatgtgcttttccttttcgttctact
gctatggaatttgctattaataataatcagatgtcagttgaagagaggatagaaaatact
gtgttacgtattccagcacctgtactagatgatattcgtggatcaagagaatatcggttg
tttgtattaagaaatatattacgggacatgttagagcattttgaaggagggatattttga

DBGET integrated database retrieval system