KEGG   Bacillus cereus ATCC 14579: BC3555Help
Entry
BC3555            CDS       T00127                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00010  Glycolysis / Gluconeogenesis
bce00053  Ascorbate and aldarate metabolism
bce00071  Fatty acid degradation
bce00280  Valine, leucine and isoleucine degradation
bce00310  Lysine degradation
bce00330  Arginine and proline metabolism
bce00340  Histidine metabolism
bce00380  Tryptophan metabolism
bce00410  beta-Alanine metabolism
bce00561  Glycerolipid metabolism
bce00620  Pyruvate metabolism
bce00625  Chloroalkane and chloroalkene degradation
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01120  Microbial metabolism in diverse environments
bce01130  Biosynthesis of antibiotics
Module
bce_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC3555
   00053 Ascorbate and aldarate metabolism
    BC3555
   00620 Pyruvate metabolism
    BC3555
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BC3555
   00561 Glycerolipid metabolism
    BC3555
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BC3555
   00310 Lysine degradation
    BC3555
   00330 Arginine and proline metabolism
    BC3555
   00340 Histidine metabolism
    BC3555
   00380 Tryptophan metabolism
    BC3555
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BC3555
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BC3555
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC3555
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BC3555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 1205900
NCBI-ProteinID: NP_833288
UniProt: Q81AK8
Position
3525565..3527049
Genome map
AA seq 494 aa AA seqDB search
MSQLAVNLHEKVEKFLQGTKKLYVNGSFIESASGKTFKTPNPATGETLAVVSEAGREDIH
KAVVAARMAFDEGPWSRMSTAERSRLMYKLADLMEEHKEELAQLETLDNGKPIRETMAAD
IPLAIEHMRYYAGWATKIVGQTIPVSGDYFNYTRHEAVGVVGQIIPWNFPLLMAMWKMGA
ALATGCTIVLKPAEQTPLSALYLAELIEEAGFPKGVINIVPGFGESAGQALVNHPLVDKI
AFTGSTPVGKQIMRQASETLKRVTLELGGKSPNIILPDADLSRAIPGALSGVMFNQGQVC
SAGSRLFVPKKMYDNVMADLVLYSKKLNQGVGLNPETTIGPLVSEEQQKRVMGYIEKGIE
EGAEVLCGGSNPFDQGYFVSPTVFADVNDEMTIAKEEIFGPVISAIPFNDIDEVIERANK
SQFGLAAGVWTENVKTAHYVASKVRAGTVWVNCYNVFDAASPFGGFKQSGLGREMGSYAL
NNYTEVKSVWLNLN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaactagctgtaaatcttcatgaaaaggtagagaaatttcttcaaggtacaaaa
aagttatatgtgaatggatctttcattgaaagcgcttccggtaaaacatttaaaacacct
aacccagcaactggtgaaacacttgccgtcgtttctgaagctggtcgcgaagatattcat
aaagctgtagtcgcagctcgtatggcttttgacgaaggtccttggtctcgtatgagcacc
gctgagcgaagccgtctcatgtacaagttagctgatttaatggaagaacataaagaagag
cttgcacagctcgaaacattagataacggaaagccaatccgtgaaacaatggcagcagac
ataccacttgcaattgagcatatgcgctattacgctggatgggctacgaaaatcgttggt
caaacaattcctgtttccggtgattactttaactatacacgccatgaagctgttggtgtc
gttggtcaaattatcccttggaacttcccgcttcttatggcaatgtggaaaatgggagca
gcgcttgctacaggatgtacaatcgttttaaaacctgcagaacaaactccactatctgct
ctatacttagctgaattaattgaagaagctggattcccgaaaggtgttattaatatcgta
cctggattcggtgaatcagctggacaagctctcgttaatcatccactcgttgataaaatt
gcatttaccggttctactcctgtcggtaaacaaattatgcgacaagcatccgaaacatta
aaacgcgttacacttgaattaggcggtaaatcaccaaatatcatattgccagatgctgat
ttatctcgcgcgattcctggtgcactttctggtgttatgtttaaccaaggacaagtatgc
tctgctggatcacgcttatttgttccgaagaaaatgtatgataatgtcatggctgatctc
gtcctctattctaaaaaactaaatcaaggtgtcggtcttaaccctgaaacaacaattggc
cctctcgtttccgaagaacaacaaaaacgtgtaatgggctacattgaaaaagggattgaa
gaaggcgctgaagtactttgcggaggaagtaatccattcgatcaaggctacttcgtttct
cctacagtattcgctgacgtaaatgatgaaatgacgatcgcaaaagaagaaattttcggt
ccagttatttctgcaataccgtttaacgatattgacgaagtaattgaacgtgcaaataaa
tcacaattcggcttagcggctggtgtgtggacagaaaatgttaaaacagcacactatgtt
gcaagtaaagtacgtgcaggtacagtatgggtaaactgttataacgtctttgatgcagca
tctccatttggaggatttaaacaatctggtcttggccgtgaaatgggatcttacgcatta
aataactatacagaagtaaagagcgtttggcttaacttaaattaa

DBGET integrated database retrieval system