KEGG   Bacillus cereus ATCC 14579: BC4023Help
Entry
BC4023            CDS       T00127                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00071  Fatty acid degradation
bce00072  Synthesis and degradation of ketone bodies
bce00280  Valine, leucine and isoleucine degradation
bce00310  Lysine degradation
bce00362  Benzoate degradation
bce00380  Tryptophan metabolism
bce00620  Pyruvate metabolism
bce00630  Glyoxylate and dicarboxylate metabolism
bce00640  Propanoate metabolism
bce00650  Butanoate metabolism
bce00900  Terpenoid backbone biosynthesis
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01120  Microbial metabolism in diverse environments
bce01130  Biosynthesis of antibiotics
bce01200  Carbon metabolism
bce01212  Fatty acid metabolism
bce02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC4023
   00630 Glyoxylate and dicarboxylate metabolism
    BC4023
   00640 Propanoate metabolism
    BC4023
   00650 Butanoate metabolism
    BC4023
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BC4023
   00072 Synthesis and degradation of ketone bodies
    BC4023
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BC4023
   00310 Lysine degradation
    BC4023
   00380 Tryptophan metabolism
    BC4023
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BC4023
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BC4023
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BC4023
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bce04147]
    BC4023
Enzymes [BR:bce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BC4023
Exosome [BR:bce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC4023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 1206368
NCBI-ProteinID: NP_833741
UniProt: Q819G0
Position
complement(3999150..4000325)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSDVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVKQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttggaggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacatgaagttgatgaagtaattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacagctgcattagcggcaggatttcctgacacagttacg
ggatatacaatccaacgtcaatgttcttcaggtatgcaagcaattatgtcagctgcaatg
caaatccaattaggtgtaagtgatgttgttgttgcaggtggggtagaagcgatgagttcg
agcccttatgcattgaaacagcaccgctggggacaacgtctacagcacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcaccatattatgatgggtgaaacagcg
gaaaatttagttaaacaatatgaaattacaagagaggaacaagatgaagttgctcttcgc
agtcatacattggcactgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagagcgtagaaaagaagttgtattttcgaaggatgaacatccacgtgca
gatattacagctgaaaaattagctggattgaagccggcgttccgtaaagatggatcagtg
actgctggaaatgcatctggccttaatgacgggagtgcagttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggtttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaaaaattatgggtattggaccagcaccagcaattcgtaaaggtttagaa
aaagtagattggtcattggaagatgcagatttacttgaaattaatgaagctttcgcggct
caatatttagctgtagagaaagagttaggcttagaccgtgaaaaagtgaacgtaaacggt
agtggcgtaggacttgggcatccaattggttgtacaggggctcgtattacagtaagttta
attcacgaattaaaaagacgtgggttagaaaaaggaattgcctctttatgcgtcggtggc
ggtatcggggttgccttatttatagaagcactataa

DBGET integrated database retrieval system