KEGG   Bacillus cereus ATCC 14579: BC4180Help
Entry
BC4180            CDS       T00127                                 

Definition
(RefSeq) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/5,10-methylene-tetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00670  One carbon pool by folate
bce01100  Metabolic pathways
bce01120  Microbial metabolism in diverse environments
bce01200  Carbon metabolism
Module
bce_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BC4180
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     BC4180
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     BC4180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH
Motif
Other DBs
NCBI-GeneID: 1206525
NCBI-ProteinID: NP_833894
UniProt: Q818R5
Position
complement(4143105..4143965)
Genome map
AA seq 286 aa AA seqDB search
MVAVIIKGNEVAEKKRAQLTEEVVKLKEQGIVPGLAVILVGEDPASRSYVKGKEKGCEQV
GIYSELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVD
GFHPISVGRMMTGQDTFLPCTPHGIVELVKETNLDISGKHVVVIGRSNIVGKPVGQLFLN
ENATVTYCHSKTQNMKELSKLADILIVAVGRPKMITADYIKEGAVVIDVGVNRLETGKLC
GDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKRAGVVCK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggtagcagtaatcatcaaaggaaatgaagttgcggagaaaaaacgagcacaattaaca
gaagaagttgtgaagttgaaagagcaaggtattgtaccaggattagcagttattttagtt
ggagaagatccagcatctcgttcttatgtgaaaggaaaagaaaaaggctgtgaacaagta
gggatttactcagagctaattgaacttcctgaaacaattactgaggaacgtttgcttgct
gaaatcgatcgcttaaatggcgatgaccgtattaatggcatattagtgcaattaccttta
ccaaaacatattgaagaaaaagctatcattgaaagaatttcaccagaaaaggatgtagac
ggatttcacccaatcagcgtgggacgtatgatgacgggacaagatacattccttccatgt
acaccgcatggtattgtagaattagtaaaagaaacaaatcttgatatttctggaaaacat
gtagtagtaattggaagaagtaatattgtcggtaaaccagtggggcaattgtttttaaat
gaaaatgccactgtcacatattgtcattctaagacgcaaaatatgaaagagttatcgaag
ttagctgatattttaatcgtagctgttggacgacctaaaatgataacagcggattatatt
aaagaaggggcggttgtaattgacgttggtgttaaccgtttagaaacaggaaaactttgt
ggtgatgttgactttgacaacgtgttagatgttgcgggttacattacacctgtgccaaag
ggtgttggtccaatgacaatcacaatgcttcttcataatactgttgaatctgccaaacgt
gcaggtgtcgtttgtaaataa

DBGET integrated database retrieval system