KEGG   Bacillus cereus ATCC 14579: BC5072Help
Entry
BC5072            CDS       T00127                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N AAA_29 RsgA_GTPase MMR_HSR1 AAA_23 NB-ARC AAA_22 NACHT ArgK DUF87 RNA_helicase AAA_18 AAA_16 AAA_14 Dynamin_N cobW NTPase_1 FtsK_SpoIIIE T2SSE AAA_24 ATPase_2 AAA_15 MukB Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 1207413
NCBI-ProteinID: NP_834740
UniProt: Q815R1
Position
complement(4978496..4980043)
Genome map
AA seq 515 aa AA seqDB search
MSLLKVESLSHSFIDKVLYENASFDLHKGEHMGIVGQNGAGKSTLMKILVGEIISDKGDI
KWQPNIQIGHLDQYAEIDEGYTISQYLKRAFYDLYEMEKRMNKLYEESAMTGDENQLLKA
AEIQGLLEAHDFYSVDSITNKVAAGLGIDVIGMNRVIGELSGGQRAKVILAKLLLEEPNI
LLLDEPTNFLDKEHVEWLANYLMNFEGAFIVVSHDFDFLEKVTSCICDVEFGTVKKYYGK
YSDFVRQKEHLRKDYIRQYYAQQKKIEKTEEYIRRNIAGVNSKIAQGRRKQLQRMERIAP
PSFTHKPSIHFQELPISVQTVLEVNNFEVGYDFALLPKLNFSVMGRQKIVITGFNGVGKS
TLLKTIVGNIDSISGEFHFSEQIKIGYYEQDLNWSNDSLTPLQIISEQFPKLNMKEIRHH
LAACGVKDTHVSQEIRTLSGGEQSKVKLCGLLLSPCNLLILDEPTNHLDAEAKEALQKAL
IKFKGSIILVSHEASFYLDWADSIFHIETGLVKGV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagtttacttaaagttgaaagtttatcacatagttttatagataaagtattatacgaa
aatgcttcttttgatttgcataaaggggagcatatgggaattgttgggcagaatggtgca
ggaaaaagcacattaatgaaaatattggtgggggaaattatttctgataagggagacata
aagtggcaaccaaatattcaaattggacatcttgatcaatacgcagaaattgatgagggt
tataccatttctcaatatttaaagagagccttttatgatttgtatgaaatggaaaagaga
atgaacaagttatatgaagaaagtgcgatgactggagatgaaaatcaactattgaaagcg
gcagaaattcaaggactgctcgaggctcatgatttttattcagtagatagtattacgaat
aaggtggcagccggtttaggtattgatgtgattgggatgaatcgtgtgattggtgaatta
agcggagggcagcgtgcaaaggtaattttagcgaagctcttattagaagagcctaatatt
ttattgctagatgaaccgacgaattttctcgataaggagcatgtggagtggcttgctaat
tatttaatgaattttgaaggagcgtttattgtcgtatcacatgattttgattttctggaa
aaggtaacttcttgcatatgtgatgtagagttcggaacagttaagaagtattacggcaaa
tactcagattttgtaagacaaaaggagcatttgcgaaaagattatattcgccaatattat
gcacagcaaaagaaaattgaaaaaacggaagagtatattcgtagaaatattgctggggtg
aattcaaaaatagcgcaaggtcgtcgaaaacaattacagcgtatggaaagaattgcgcca
ccaagttttactcataaaccgtctattcattttcaggaacttcccatttcagttcagaca
gttcttgaagtaaataactttgaagttggttacgacttcgctctcttaccaaagttgaat
ttttcagtaatgggtaggcaaaaaattgttattacaggtttcaatggagtaggaaaatct
actttattaaaaacaatcgttggaaatattgatagtatttctggagagtttcacttttca
gagcaaataaagattggatattatgagcaagatttaaattggagcaatgattctttaacg
ccgcttcaaattatttcagaacagtttcctaaactgaatatgaaggaaatacgccatcat
ttagctgcgtgtggagtgaaggatacgcacgtttcgcaagaaattcgtacgttaagtggt
ggtgaacaatcgaaggtgaaactgtgcggattattattatcaccttgtaacttattaatt
ttagatgagccgacaaatcatttagatgcagaagcgaaggaagctttgcaaaaggcgtta
attaagtttaagggcagcattatactcgtatctcacgaagcgagtttttatcttgattgg
gcagatagtatctttcatatagagacgggattagttaagggggtgtga

DBGET integrated database retrieval system