KEGG   Bacillus cereus ATCC 14579: BC5075Help
Entry
BC5075            CDS       T00127                                 

Gene name
rplK
Definition
(RefSeq) 50S ribosomal protein L11
  KO
K02867  large subunit ribosomal protein L11
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce03010  Ribosome
Module
bce_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BC5075 (rplK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bce03011]
    BC5075 (rplK)
Ribosome [BR:bce03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    BC5075 (rplK)
  Bacteria
    BC5075 (rplK)
  Archaea
    BC5075 (rplK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11
Motif
Other DBs
NCBI-GeneID: 1207416
NCBI-ProteinID: NP_834743
UniProt: Q812H1
Position
complement(4982430..4982855)
Genome map
AA seq 141 aa AA seqDB search
MAKKVLKVVKIQLPAGKANPAPPVGTVLGPTGVNIMMVCKEYNALTQGQAGMIIPAEITI
YEDRSFSMKIKTAPVAELLKREAGISKGSGEPNKSKIGSITEEKLREIAEYKFPDMNAAS
VEAAMRTIEGTARSMGITVQK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaagttttaaaggttgtaaaaatacagctaccagcaggtaaagcaaaccca
gctccaccggttggtacagttttaggtcctaccggggtaaatattatgatggtgtgtaag
gaatataatgctcttacacagggacaagctgggatgattattccagctgaaattactatc
tatgaagatcgatctttttcaatgaaaataaaaacggccccagtagccgaattattaaag
cgtgaggctggaatttcaaaaggatctggagaacctaataaaagtaaaataggctcaatt
actgaagaaaaactaagggaaattgcagaatacaagtttccagacatgaatgcagcatca
gtagaagcagcaatgagaacaattgaaggtaccgcgagaagcatgggtattacagttcaa
aaataa

DBGET integrated database retrieval system