KEGG   Bacillus cereus ATCC 14579: BC5080Help
Entry
BC5080            CDS       T00127                                 

Definition
(RefSeq) methyltransferase
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 CMAS Methyltransf_12 Methyltransf_31 Ubie_methyltran Methyltransf_23 DOT1 PrmA Methyltransf_8 PCMT Methyltransf_4 Methyltransf_18 Methyltransf_9 MTS Methyltransf_32 RrnaAD Rsm22 N6_N4_Mtase ADH_zinc_N Methyltransf_15
Motif
Other DBs
NCBI-GeneID: 1207421
NCBI-ProteinID: NP_834748
UniProt: Q815Q5
Position
complement(4985716..4986513)
Genome map
AA seq 265 aa AA seqDB search
MYENNVKDTKDFYNDIGHISWSVAPSQHYHVGIFELEKDSMEDAQNRTVEYMARKVAASD
LDVLLDIGCGSGLTAVQISKKENCKIVGINISEKQLAIGKKLISKEKINSRVKLMNMDAH
QLNFKSGMFDGAYALESIMHMNREKVLSEVHRVLKNGAPFSLCDWYVKKSLTPVEKRFLE
TITLGKYITKEQYFSLYQTQNFMDIEIEEWSNKILPTYKYWTTITDEMKEKLPDHLLYVI
EENSKVLSDIAIEKLGYLQVNGIKR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaaataatgtaaaagatacaaaggatttttataatgatatagggcatataagt
tggagtgttgccccctcgcaacactatcatgtgggaatttttgaattagaaaaagattcc
atggaggatgctcaaaatagaacggtagaatatatggcacgtaaagttgcggcatcagat
cttgacgtactattagatattggatgtggctccgggcttactgcagtacaaattagtaaa
aaggaaaattgtaaaattgtaggtataaatatttccgaaaagcaacttgcaattgggaaa
aagctaatttctaaagagaaaattaatagcagggtaaagctaatgaatatggacgcacat
caattaaactttaagtcaggtatgtttgatggtgcatacgctctagagagtatcatgcat
atgaatagggaaaaggttttaagtgaggtacatagagtattaaaaaatggtgctcctttt
agtttatgtgattggtatgtaaagaaatctttaactccagtagagaagaggtttttagaa
accattacacttggtaagtatattacaaaggaacagtattttagtctttatcaaactcaa
aatttcatggatattgaaattgaagaatggagcaataaaatattaccgacttataaatat
tggacgacgattacggatgaaatgaaagaaaaacttcctgatcatttactatatgtaata
gaagaaaattctaaagtactatcagatattgcaattgaaaaattaggatatttacaagtg
aatggaataaaacgttag

DBGET integrated database retrieval system