KEGG   Bacillus cereus ATCC 14579: BC5089Help
Entry
BC5089            CDS       T00127                                 

Definition
(RefSeq) lantibiotic precursor peptide
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 DUF134
Motif
Other DBs
NCBI-GeneID: 1207430
NCBI-ProteinID: NP_834757
UniProt: Q812G9
Position
complement(4996832..4996990)
Genome map
AA seq 52 aa AA seqDB search
MSEIKKALNTLEIEDFDAIEMVDVDAMPENEALEIMGASCTTCVCTCSCCTT
NT seq 159 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaattaaaaaagcattaaatacgcttgaaattgaagattttgatgcaattgaa
atggttgatgttgatgctatgccagaaaacgaagcgcttgaaattatgggagcgtcatgt
acgacatgcgtatgtacatgcagttgttgtacaacttga

DBGET integrated database retrieval system