KEGG   Bacillus cereus ATCC 14579: BC5092Help
Entry
BC5092            CDS       T00127                                 

Definition
(RefSeq) glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:bce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC5092
Enzymes [BR:bce01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     BC5092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase_2 Glyoxalase DUF244 Hydrolase_3 CppA_N
Motif
Other DBs
NCBI-GeneID: 1207433
NCBI-ProteinID: NP_834760
UniProt: Q812K2
Position
4998132..4998464
Genome map
AA seq 110 aa AA seqDB search
MIKELDHVMIKVQNLEESITFYSEQLRLQIIWEYDNYVGFHNGIVIHDSKNSENLTSFFK
VDSVEETVKILKESNVKIILEPTPIPTGYTAAFQDISNNIIHIVDNINLS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagaacttgatcacgtaatgataaaagtccaaaatctagaagaaagtattact
ttttattcagagcagttacgactgcaaataatctgggagtatgataattatgtaggattt
cataacggtatagttattcatgattcgaaaaacagtgaaaatttaactagctttttcaaa
gtagattctgtagaagaaacagtcaaaatattaaaagagagcaatgttaaaattatttta
gagcccactcctattccgactggatatacagcagcctttcaagacatcagtaataacatt
attcatattgtagataatattaatctttcttga

DBGET integrated database retrieval system