KEGG   Bacillus cereus ATCC 14579: BC5359Help
Entry
BC5359            CDS       T00127                                 

Definition
(RefSeq) aminopeptidase
  KO
K19701  aminopeptidase YwaD [EC:3.4.11.6 3.4.11.10]
Organism
bce  Bacillus cereus ATCC 14579
Brite
KEGG Orthology (KO) [BR:bce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bce01002]
    BC5359
Enzymes [BR:bce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     BC5359
    3.4.11.10  bacterial leucyl aminopeptidase
     BC5359
Peptidases and inhibitors [BR:bce01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   BC5359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 PA Peptidase_M20 Peptidase_M42
Motif
Other DBs
NCBI-GeneID: 1207699
NCBI-ProteinID: NP_835020
UniProt: Q814R3
Position
5278137..5279537
Genome map
AA seq 466 aa AA seqDB search
MRKSLKQKIVSSLLAVSLAVSLAPIGQAKADSTSEVTQTPSITKQIDPNRAIEHVRFLSE
TIGPRPGGTKSEEWASRYIGMQLKSMGYDVEYQPFQVPDQYVGFIESPLSTKRNWQAGAA
PNALISTEAITAPLIFVQGGTKLEDIPNEVNGKIVLFERGTTVTDYNKQVENAVSKGAKG
VLLYSLIGGRGNYGQTFNPRLTKKQSIPVFGLAYAQGNAFKEEIAKKGTTILSLKARHES
KLTSLNVIAKKKPKKSTGNEKAVVVSSHYDSVVGAPGANDNASGTGLVLELARAFQNVET
DKEIRFITFGSEETGLLGSDYYVNSLSQKERDRILGVFNADMVATNYDKAKNLYAMTPDG
STNFVTDAALQAGKQLNNDLVLQGKFGSSDHVPFAEAGIPAALFIWMGVDSWNPLIYHIE
KVYHTPQDNVLENISPERMRMALDVIGTGVYNSLQKPVPQTEQKAA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatcattgaaacaaaaaatagtaagctctttgcttgctgtatcactcgctgtt
agcttagctccaattgggcaagcaaaagcggattccacgtcagaggttacacaaactcca
tctattacaaaacagattgatccaaaccgcgcgattgaacatgttcgtttcttatctgaa
acaattggtcctcgccccggtggaacaaaatccgaagaatgggcttctcgttacattggt
atgcagcttaaatcaatgggctatgacgtagaatatcaaccatttcaggtgcccgatcaa
tacgttggattcattgaatcaccactatcaacaaaacgtaattggcaagctggtgctgct
cctaatgcactcatttctacagaagctattacagccccccttatctttgttcaaggtggg
acaaaattagaagatattccaaatgaagtaaacggtaaaattgttttatttgaaagagga
acgacagttacagactataataaacaagttgaaaatgctgttagcaaaggtgcaaaaggt
gttcttttatacagtttaattggcggacgcggaaattatggacaaaccttcaatccccgc
ctaacgaaaaagcagtctatccctgtctttggtcttgcttatgcgcaaggaaatgcattt
aaagaagaaatcgctaaaaaagggacaacaattctttccctaaaagcgagacatgaatct
aaattaacatctctaaatgttatcgccaaaaagaaaccaaaaaagagtacaggtaatgag
aaagcagtcgttgtaagctcgcactatgatagtgttgtcggagcacctggcgcaaatgat
aatgcttctggaactggattagtattagaactagctcgtgcttttcaaaatgtagaaact
gataaagaaattcgctttattacctttggttctgaagaaactggattacttggttcggat
tattacgtgaatagtctatcccagaaagaacgcgaccgtattttaggtgtctttaacgcc
gacatggttgcaacaaattatgataaagcaaagaatttatacgctatgacacctgatggc
tctacaaactttgtaacagacgctgccttgcaagcaggtaaacaactaaataatgacctc
gtcctacaaggtaaattcggttctagtgatcatgttccatttgctgaagctggtattcct
gctgctctattcatttggatgggtgtcgatagttggaatccattaatctatcatattgag
aaggtataccatacacctcaagataacgtattagaaaacatttcacctgaacgaatgaga
atggcattagacgttatcggaacaggagtttataactcgcttcaaaaacctgttcctcaa
actgaacagaaagctgcttaa

DBGET integrated database retrieval system