KEGG   Burkholderia cepacia DDS 7H-2: DM42_162Help
Entry
DM42_162          CDS       T03302                                 

Definition
(GenBank) AMP-binding enzyme family protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00061  Fatty acid biosynthesis
bced00071  Fatty acid degradation
bced01100  Metabolic pathways
bced01212  Fatty acid metabolism
bced02024  Quorum sensing
Module
bced_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DM42_162
   00071 Fatty acid degradation
    DM42_162
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DM42_162
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bced01004]
    DM42_162
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bced04147]
    DM42_162
Enzymes [BR:bced01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     DM42_162
Lipid biosynthesis proteins [BR:bced01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   DM42_162
Exosome [BR:bced04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   DM42_162
  Exosomal proteins of breast cancer cells
   DM42_162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AIO47454
UniProt: A0A095DW94
Position
1:183593..185347
Genome map
AA seq 584 aa AA seqDB search
MSSSAATTSAQLPPNTDAIWYASYPPGVPHEIDVTQYASLVQFFDECTTRFADRVAYVSA
GASMTYRTLAQKVDAFASYLQSLGVKPGDRVAIMLPNTFQYPVALFGTLKAGAIVVNVNP
LYTARELAHQLKDSGAQTIVVFENFARTLQDALPETQVKHIVVTALGDLLADGFNAKGRL
INFVLKHVKKLVPDYHLPQAIRLRSALALGARGAPQPVQTTRDDLAFLQYTGGTTGVAKG
AMLTHGNLIANLLQAKAWIADQVSGDVETVLTPLPLYHIYSLTVNAFIFMGLGGRNILIA
NPRDMKMVMKIIRHETFTGITGINTLYNAFLDNEEFRKRDFSKLKLAMAGGMAMQRAVAE
RFQQVTGRPVVEGYGLTECSPIVTMNPVDLNDMAAFSGSIGLPAPSTLVRFRREDGTWAA
IGEPGELCVRGPQVMRGYWQRPDETAKVIDADGWLGTGDIGVMDERGFIRLIDRKKDMIL
VSGFNVYPNEIEEVLVMHPGISEAAAIGIPDEVQGERIKVFVVRRDPSLTAEDVLAHCRK
NLTGYKMPKFVEFRDALPQTNVGKILRRALRDEELAKLNAAKQG
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcttccgcagcaaccacctcggcccagcttccgccgaacaccgacgccatctgg
tacgcgtcgtacccgcccggcgtcccgcacgagatcgacgtcacgcaatacgcgtcgctc
gtgcagttcttcgacgaatgcacgacgcgcttcgccgaccgcgtcgcgtatgtcagcgcc
ggcgcgtcgatgacctatcgcacgctcgcgcagaaggtcgacgcattcgcgtcgtatctg
caaagcctaggcgtgaagcccggcgaccgcgtcgcgatcatgctgccgaacacgttccag
tatccggtcgcgctgttcggcacgctgaaggccggcgcgatcgtcgtcaacgtgaatccg
ctctacaccgcgcgcgaactcgcgcaccagttgaaggacagcggcgcgcagacgatcgtc
gtgttcgagaacttcgcgcgcacgctgcaggacgcgctgccggaaacgcaggtgaagcac
attgtcgtcaccgcgctcggcgacctgctcgccgacggtttcaacgcgaaaggacgcctg
atcaatttcgtgctgaagcacgtgaagaagctcgtgccggactaccacctgccgcaggcg
atccggctgcgctccgccctcgcgctcggcgcgcgcggcgcgccgcaaccggtgcagacc
acgcgcgacgatctcgcgttcctgcaatacaccggcggcacgaccggcgtcgcgaaaggc
gcgatgctcacgcacggcaacctgatcgcgaacctgctgcaggcgaaggcgtggatcgcc
gaccaggtgtcgggcgacgtcgaaaccgtgctcacgccgctgccgctctatcacatctat
tcgctgacggtgaacgcgttcatcttcatggggctcggcgggcgcaacatcctgatcgcg
aacccgcgcgacatgaagatggtgatgaagatcatccgccacgagacgttcacgggcatc
accggcatcaacacgctgtacaacgcattcctcgacaacgaggaattccgcaagcgcgac
ttctcgaagctcaagctcgcgatggcgggcgggatggcgatgcagcgcgcggtcgccgag
cgcttccagcaggtgacgggccggccggtggtcgaaggctacggcctcaccgagtgctcg
ccgatcgtcacgatgaaccccgtggacctgaacgacatggccgcgttcagcggttcgatc
ggcctgcccgcgccatctaccctcgtgcgctttcgccgcgaggacggcacctgggccgcg
atcggcgagccgggcgagctgtgcgtgcgcggcccgcaggtgatgcgcggctactggcag
cgccccgacgagaccgccaaggtgatcgacgccgacggctggctcggcaccggcgacatc
ggcgtgatggacgagcgcggcttcatccgcctcatcgatcgcaagaaggacatgatcctc
gtgtcgggcttcaacgtgtatccgaacgagatcgaggaagtgctggtgatgcatccgggc
atcagcgaagccgcggcgatcggcattcccgacgaggtgcagggcgaacggatcaaggtg
ttcgtcgtgcgccgcgacccgtcgctgacggccgaggacgtgctcgcgcactgccgcaag
aacctgaccggctacaagatgccgaaattcgtcgagttccgcgacgcgctgccgcagacg
aacgtcggcaagatcctgcgccgcgcgctgcgcgacgaggaactcgccaaactcaacgcc
gcgaagcaaggctga

DBGET integrated database retrieval system