KEGG   Burkholderia cepacia DDS 7H-2: DM42_2423Help
Entry
DM42_2423         CDS       T03302                                 

Gene name
sucC
Definition
(GenBank) succinate-CoA ligase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00020  Citrate cycle (TCA cycle)
bced00640  Propanoate metabolism
bced00660  C5-Branched dibasic acid metabolism
bced01100  Metabolic pathways
bced01110  Biosynthesis of secondary metabolites
bced01120  Microbial metabolism in diverse environments
bced01130  Biosynthesis of antibiotics
bced01200  Carbon metabolism
Module
bced_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bced_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM42_2423 (sucC)
   00640 Propanoate metabolism
    DM42_2423 (sucC)
   00660 C5-Branched dibasic acid metabolism
    DM42_2423 (sucC)
Enzymes [BR:bced01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DM42_2423 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp K-cyclin_vir_C
Motif
Other DBs
NCBI-ProteinID: AIO49620
UniProt: A0A095ET65
Position
1:2617021..2618187
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMIEEGADIKQELYVSLVVDRVSQK
IVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQADDLAAKIGVPAASIPQARAI
LQGLYKAFWETDASLAEINPLNVSGDGKVTALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPGLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LADSGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggttgacgaggccgtcaaggtggcggaagagctcggcggc
ccggtatgggtcgtgaaggctcagattcacgcgggtggccgtggcaagggcggcggcgtg
aaggtggcgaagtcgatcgagcaggtccgcgaatacgcgaaccagatcctcggcatgcaa
ctcgtcacgcaccagaccggtccggaaggccagaaggtcaaccgtctgatgatcgaagaa
ggcgccgacatcaagcaggaactgtacgtcagcctcgtcgtcgatcgcgtgtcgcaaaag
atcgttctgatgggttcgagcgaaggcggcatggacatcgaagaagtcgccgaaaagcac
ccggaactgatccacaaggtcatcgtcgagccgtcgacgggcctgctggacgcgcaggcc
gatgacctcgccgcgaagatcggcgtgccggctgcttcgatcccgcaagcgcgcgcgatc
ctgcaaggcctgtacaaggcattctgggaaaccgacgcatcgctggctgaaatcaacccg
ctgaacgtctccggcgacggcaaggtcaccgcactcgacgcgaagttcaacttcgactcg
aacgcgctgttccgccacccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgcctcgtgaacggcgcgggcctcgcgatggcgacgatggacaccatcaagctgttcggc
ggcgaaccggcgaacttcctggacgtcggcggtggcgcgacgaccgagaaggtcacggaa
gcgttcaagctgatgctgaagaacccgggcctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgccggttcgaaggccgtgaac
ctgaacgtgccgctcgtcgtgcgcatgaagggcacgaacgaggacctcggcaagaagatg
ctggccgattcgggcctgccgatcatctcggcggacagcatggaagaggctgcgcagaag
gtcgtcgcggctgccgcaggcaagtaa

DBGET integrated database retrieval system