KEGG   Burkholderia cepacia DDS 7H-2: DM42_4560Help
Entry
DM42_4560         CDS       T03302                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00900  Terpenoid backbone biosynthesis
bced01110  Biosynthesis of secondary metabolites
bced01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM42_4560
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     DM42_4560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AIO44577
UniProt: A0A095F9F4
Position
2:complement(1174449..1175735)
Genome map
AA seq 428 aa AA seqDB search
MPIDSALPNFRSLTPEQRLSHLARVVGLDDAEHALLARPGALPLDTANGMIENVIGTFEL
PMAVAGYFRINDRDVIVPMAVEEPSIVAAASYMAKLSRAAGGFRTSSSGPLMRAQVQVVG
VDDPYGARLAILRHAAELIALANSRDKVLVGLGGGCRDIEVHVFPDTPRGAMIVAHLIVD
VRDAMGANTVNTMAETVATRIEAITGGQVRLRILSNLADLRLARAEVRYSAATLATDDYA
GEAVIDRVIDAYVFAATDPYRAATHNKGIMNGIDPVVVATGNDWRAVEAGAHAYASRSGR
YTSLTTWEKAANGDLVGTIEMPMPVGLVGGATKTHPLARLALKIMNVTSAQELGEIAVAV
GLAQNLGALRALATEGIQRGHMALHARNIAVAAGATGADIDRIAQRMVAAKDVRTDFAVE
LLAGRSDG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcgattccgccttgccgaacttccgctcgctgacgcccgagcaacgcctgtcc
cacctggcccgtgtcgtcgggctcgacgatgccgagcacgcgctgctcgcccgaccgggt
gcgttgccgctcgataccgcgaacggaatgatcgagaacgtgatcggcacgttcgagctg
ccgatggcggtggccggctacttccggatcaacgaccgggacgtgatcgtgccgatggcc
gtcgaggagccgtcgatcgtggcggccgcatcgtacatggcgaagctgtcgcgcgcggcg
ggcggcttccgcacgtcgagcagcggcccgctgatgcgtgcgcaggtccaggtggtcggc
gtcgacgatccgtacggcgcgcggctcgcgatcctgcgtcatgcggccgaactgatcgcg
ctcgcgaacagccgcgacaaggtgctggtcggcctcggcggcggctgccgcgacatcgag
gttcacgtgtttcccgacacgccgcgcggcgcgatgatcgtcgcgcacctgatcgtcgac
gtgcgcgacgcgatgggcgcgaacacggtcaacacgatggccgagaccgtcgcgacgcgc
atcgaggcgattaccggcggccaggtacggttgcggatactgtccaacctcgccgacctg
cggttggcgcgcgcggaggtacggtactcggccgcgacgctcgcgaccgacgattacgcc
ggcgaagcggtgatcgaccgcgtgatcgacgcatacgtgttcgcggcgaccgatccgtac
cgcgcggcgacccacaacaagggcatcatgaacggcatcgatccggtggtggtcgcgacc
ggcaacgactggcgcgcggtcgaagccggcgcgcatgcatacgcgagccgcagcggccgc
tatacgtcgctgacgacgtgggagaaggccgcgaacggcgacctcgtcggcacgatcgag
atgccgatgccggtcgggctcgtcggcggcgcgacgaagacgcatccgctcgcgcgcctc
gcattgaagatcatgaacgtgacgtccgcgcaggaactcggcgaaattgcggtcgcggtc
gggcttgcgcagaatctcggggcgctgcgtgcgctcgcgaccgaaggaatccagcgcggc
cacatggcgctgcatgcgcgcaacatcgccgtcgcggccggcgcgacgggcgccgacatc
gaccggatcgcgcagcggatggtcgcggcgaaggacgtgcgtaccgatttcgccgtcgag
ctgctcgcgggccgcagcgacggctga

DBGET integrated database retrieval system